close all open/close all

CDS information : Salino_00880


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction99,373 / 99,855 / + [in whole cluster]
99,373 / 99,855 / + [in contig]
Location99373..99855 [in whole cluster]
99373..99855 [in contig]
TypeCDS
Length483 bp (160 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative transcriptional regulator
Gene
Gene (GenBank)salO
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Related Reference
ACC
H6D566
NITE
Salino3_00100
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)

close this sectionSequence

selected fasta
>hypothetical protein [putative transcriptional regulator]
MDETRPRRYEGEVPDFVERFAADLTEAGMPRMSARVFACLLAEDSGQLSSAELAERLRAS
PAAISGAVRYLSQIHMVGREREPGSRRERYRVRADIWYEAFTSRDKELSRWESTLKSGVD
ILGPETEAGRRLAETADFFEFMQSELATLMDRWRARRAGS
selected fasta
>hypothetical protein [putative transcriptional regulator]
GTGGACGAGACCCGACCGCGGCGCTACGAGGGAGAGGTGCCGGACTTCGTCGAGCGCTTC
GCCGCCGATCTCACCGAGGCGGGCATGCCCAGGATGTCCGCCCGCGTCTTCGCCTGCCTG
CTCGCGGAGGACAGCGGCCAGCTCAGCTCCGCCGAACTCGCCGAACGGCTCAGAGCCAGC
CCCGCCGCGATATCCGGCGCGGTCCGCTACCTCTCGCAGATCCACATGGTCGGCCGGGAG
CGCGAACCCGGCTCCCGGCGCGAGCGCTACCGGGTCCGCGCCGACATCTGGTACGAGGCC
TTCACCAGCCGCGACAAGGAGCTCTCCCGCTGGGAGTCGACCCTGAAGTCGGGTGTGGAC
ATCCTCGGGCCGGAGACCGAGGCCGGACGGAGACTGGCCGAAACCGCCGACTTCTTCGAG
TTCATGCAGAGCGAACTGGCCACCCTGATGGACCGCTGGCGGGCCCGCCGCGCCGGGAGT
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [16-90]  8.4e-11 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
SignalP
 [1-38]  0.032 Signal
Eukaryota   
TMHMM No significant hit