close all open/close all

CDS information : Salino_00910


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction102,994 / 117,771 / + [in whole cluster]
102,994 / 117,771 / + [in contig]
Location102994..117771 [in whole cluster]
102994..117771 [in contig]
TypeCDS
Length14,778 bp (4,925 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I modular polyketide synthase
Gene
Gene (GenBank)salAI
EC number
Keyword
Note
Note (GenBank)
  • Polyketide synthase domains: KSQ, AT, ACP, KS, AT,KR, DH, ACP, KS, AT, KR, ER, DH, ACP
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Related Reference
ACC
H6D569
NITE
Salino3_00130
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)

close this sectionPKS/NRPS Module

0 malonyl-CoA
1 ethylmalonyl-CoA
2 malonyl-CoA
KSQ23..388
AT545..864
ACP941..1011
KS1031..1407
AT1553..1875
DH1925..2088
KR2394..2574
ACP2681..2751
KS2776..3151
AT3311..3620
DH3667..3831
ER4163..4469
KR4479..4659
ACP4765..4835

close this sectionSequence

selected fasta
>polyketide synthase [type I modular polyketide synthase]
MADPVNSRQAPRAARTPDRSTGPVAVVGMACRFPQADGPGAYWRLLSEGTDAVTEVPEAR
RAAVPEGAEGAGARGGFLDRIDAFDAAFFGISPREAAAMDPQQRLVLELVWEALEDAGTL
PGALKNSATGVYVGAIWDDYAALVKRHGDPAVTQHTFTGLNRGVIANRVSYTLGLRGPSL
TVDTAQSSSLVAVHLACQALLSGEADLALAGGVNLLIDPASSEITARFGGLSPSGRCHTF
DERADGFVRGEGGGVVVLKPLDAALADGDRVHCVILGSAVNHDGATDGLTVPSAEAQTEV
VRHALAAAGQSPDQVQYVELHGTGTPVGDPVEATALGAAFEGRGESAPVAVGSAKTNIGH
LEAAAGIAGLVKAALAIRHRELPPSLHFRAANPAIDLPALGLRVQDRRGPWPAPEQPLIA
GVSSFGLGGANAHVVLGEAPAPAAAPEPKGATAPARPLLFPVSGRGDKALRAQAARLAAH
LAAEPGHPPAALARALATTRTAHKDRAVVLGHQLPELLAGLGSLADGNSSAQLVQGRALP
GATAFLFTGQGSQRPGMGRELHAAEPEFARAFDEVCAVLDPLLDRPLREIAFAGADSPEA
ALLDRTAYTQPALFAFEVALYRLLEHLGARPDFLVGHSIGELAAAHVAGVLSLADAARLV
AARGRLMDALPEGGAMAALEATEEELAPLLDEHGGRLDLAAVNGPRAVVVSGDAAAVDEA
AAHFAAQGRKTKRLRVSHAFHSAHMDGMLDAFRGVAEELTYRPATLPIVSNLTGQPVADE
EIGTADYWVRHVRGAVRFAEGIAALEAAGVTRYVEIGPDGALSSMGRECADPESAFVPVQ
RGTRTPEAEALTAALARMHTVGIDLDPDALYGPAEPGHIALPTYAFQRRGHWIDTTGTAR
PAPAAPRAAAPAPEAIEEDRPGSALRERLGALSAAEQDRSLHRLLREHIATVLRLDPTDE
IDLRSTFHELSFDSWTAVELRDGLSAATGLALPSSLLFDYPTPLALAGYLRELALGGGEE
TALAPTVSAGDEPIAIVAMSCRFPGGVDTPEQLWSVLAEGRDVIGAFPTDRGWDLEGLYD
PEGTQPGKHYVREGGFLGGATRFDPAFFGISPREATSMDPQQRLLLETSWEAVERAGIDP
AALRGTQTGVFVGATFQDYGPRLHEGTETTEGYLMTGSTPSVASGRIAYTLGLTGPAVTV
DTACSASLVALHLAAQSLRQGECSLALAGGVTVMPTPGIFVELTRQRALSADGRCKSFAA
SADGTGWSEGAGVLLLEKLSDARRHGHQVLAVIRGSATNQDGASNGLTAPNGPSQQRVIR
QALANAGVTADSVDAVEAHGTGTKLGDPIEAHALLATYGTLRGESLPLRLGSLKSNIGHT
QQAAGVAGVIKMVLALQNETLPQTLHAAEPSPHIDWSAGAVELLNAPAPWPRGERPRRAG
VSSFGISGTNAHLILEEAPAEAESAPARTPEQDRPLPWLLSARSEEGLRVQSARLAAFAA
DQPDALALASALATSRTAFEYRAAAIGDTHAELLTALERPAVRGFAAPRNKTVFVFPGQG
SQWAGMAVELLDSSPVFAARFAEVASAVEEYVDWSVESVVRGADGTPSLDRIEILQPVLF
TVMVSLAAVWQSVGVTPDAVVGHSQGEIAAAAVSGALSLEDAAQVVVLRSQLFADELVGK
GAVASVSLPAAEVEARIARFNGDAEVLSIAGNNGPRSVTVAGQVAALEELVAELEAEGVR
AKVIGSTVASHCAQVDPLHERILDLLSFVQPREGSVPLYSTVNGEVLSGAELDASYWFEN
CRRPVSFEPVVRALIADGFDVFVESSAHPVLTYGISETSDDVGVEVLAQGTLRRQEGGLR
RVLTSFAEAWTRGVALDWTAVLPEPVRDLGPVLPTYPFQRERYWLDMADASAADVGSAGL
RAPGHPLLGAAVRLAEGDQYLLTGRVSLKTHPWLADHGAMGSVLLPGTAFVELVVRAGDE
AGCEHLEELTLEAPLLLPEHSGVQLQVGVGPADASGRRQVSVHSRAEAEEAEETWVRHAL
GFLAPAGTHGPQTLEAWPPAGAEALDLADFYARTAEAGYGYGPAFQGLHKAWGSGEEIFA
EVALAPEQREQAAEFGLHPALLDAALHAEQLLRAARGEDAGVRLPFVWSGLTLHAVGAAA
LRLRMTSLGTDTVSLLVTDTEGRPVASADSLVLRPVAAEQFTGGAAREGLYRVEWSPVPA
GGGTPADWAEIGGSAFPDLAALTAALDEGMAVPPVVVVAREPEEVADPGLLAERARAATA
GMLALVQDWLAEDRFAGSRLAVVTRGAMAVRAGEDVTDLVHAPLWGLLRSAQSENPDRFV
LLDRDPWDSTGGDLPAALATGESQLAVRDKALLVPRLSRSAGQPAARPRWNPEGTVLITG
GTGTLGALLAHHLVTEHGVRRLLLTGRRGPEAPGAAALADSLAALGAEAEVVACDAADRG
ELAALLDRIPEAHPLTGVFHAAGVLDDGMVGALSAERLDAVLRPKTDAVWHLHELTRDLD
LTAFVLFSSIAGVFGNPGQSNYAAANAFMDALAHRRHAEGLPASSLAWGLWQEASGLLAH
LEDGDLGWMSRAGIQPLASDHGLALLDAALRTPGEALLVPVSLNTATLRGRAASGLLPGL
FRQLVRVPARRTVETGAAEDGSSALVRRLAALGEAEQERELTDLVRESVAAVLGHGDPAA
ISADRAFKALGFDSLTAVELRNQLGAATGIRLPATLIFDHPTLTAAARFLRGELLGAEAA
VPAELPDTPVQGGTGEPIAIVAMACRYPGGVASPEDLWELVAEGRDAVSGFPTDRGWDLD
TLFDQDPEKLGTSYAREGGFLYGAGDFDPELFGISPREALAMDPQQRLLLETSWELFERA
GLGLDAVRGSRTGVFAGAMHHDYAFRVEENAQRVEGYGLTGTQGSVVSGRVSYAFGLQGP
AVTVDTACSSSLVAMHLAAQSLRQGECQMALAGGVAVMATPGVFVEFSRQRGMAADGRCK
SFAADADGTGWAEGVGLVLLERLSDARRNGHQVLAVLRGSATNQDGASNGLTAPNGPAQQ
RVIRQALANARLGADEVDAVEAHGTGTTLGDPIEAGALLATYGKERAGRSPLWLGSLKSN
IGHAQAAAGVAGVIKMVQAMRHGKLPRTLHAEVPTPEVDWESGAVRLLDEGVDWPETGRP
RRSAVSSFGISGTNAHVVLEEAPAAPAAEAPAAGTESGMAAGLVAWPLSARGERALRGQA
GRLADWADAGTGLSATASALVHRRSALEHRAVVTADSLEGQLAALRALAAGEEAPGLRQG
QLPATQGRLAFLFSGQGAQRAGMGRELYAAEPVFAAAFDEVCAAFGEDLRERIFTARQEE
LDRTGTTQPALFAIEVALFRLVESLGVRPDFVAGHSIGELAAAHVAGVLSLPDACRLVAA
RGQLMEALPEGGAMVSVRATEDEVRAHLAEFTGRVDVAAVNGPESVVLSGEEAAVEEIAG
RLAEAGRKTRRLRVSHAFHSPLMEPMLDAFRRVAEELTYQAPSVPVVSNLTGEQVTAFDA
AYWVEHVRRAVRFADGIGFLASRGVTRFVELGPDGVLTAMAQETLTDPETLLLPVLRKDR
PEPEAFLDALAQAWTRGVDVDWAARYGPEQSTGVSLPTYAFQHERYWLAPVAGASDAAGL
GLAAAGHPLLGAAVHLADGQGLVLTGRVAAGTRPWLADHAVGGSVLLPGTAFVGLALRAG
EEAGLGRLAELTLEAPLVLPAQGAVQLQVVVGTGPEGEAADTRGVEIHARPENGQGTWTR
HASGTLAPQGPAPAAEAAAWPPAGAEAVPLDGFYERLADSGYGYGPAFQGLKAAWRDGED
LCAEVALAPEQQEEAAEFGLHPALLDAALHPVLLGLAESGAGEVKLPFAWSGVSLHAEGA
SALRVRMRGAAEGSVSVTLTDTTGLPVAEIDSLTLLPVPAGQLGAAPAQEGLFRLDWTQV
TADHEPERDWAVLGEQLPAAHRTDGSPVYADVAELLAAARGEAGAPAAVLLPVPRAENGV
TAEAVHTESARLLAVLQAWLAEELLEGTKLVVLTHGAVAARHGEDVGDLTHAALWGLVRS
AQTENPGRFVLVDTDLSAASAAEGAENTAEDLSVLAAVATGEDQIAVREGRFLTPRLARG
GSGELLTPPADAPSWRLDTTGGGTLESLSLVPHEEALRPLAAGEVRVSVRATGLNFRDVL
MALGMYPDKIVLGSEAAGVVTETGPGVSRLAVGDRVMGMIPHSFGQLAVADARMLAPMPG
GWSFEQAASVPAVFLTAYYALVDLAGLGARERVLIHAAAGGVGMAAVQLARHLGAEVFGT
ASEGKWDTLRDLMGFGGAHYGSSRSSTFEERFRTATGGEGMDVVLDCLAGELVDASLRLL
PRGGRFVEMGKTDIREPEQVARDYPGVRYQAFDLMEAGPDRIGEMLAELAGLFEAGVLKP
LPVRSWDIRRAGEAFRFMSQARHVGKIVLTVPQVWDPSGTVLVTGGTGTLGALVARHLVV
EHGVRHLVLAARRGPEAPGAAELVAELGGLGAQAEVVACDAADRGQLAKLLDGIGAAHPL
RAVVHTAGVLDDGVLAAQSPERLSRVLRPKADAAWHLHELTRDVDLTAFVLYSSAAGVLG
NAGQSNYAAGNTFLDALAAHRRAQGLPGVSLAWGHWAQSSEMTAGLGSADLARLGRSGFL
PMSDAEGLRLFDAAVAGDEALLAPVPLDLAALRARGRTGELPGVFRGLVRTTVRRTVSAA
AAGATEIPLAERLAALPEGEREHTLLELVRANVATVLGHGVPAAIGADRTFKELGFDSLT
AVEFRNRLGAATGLRLPPTLIFDYPTTVTLAGHLLGELVPAAAPDTPADLLGELQRFENA
VLGADPADGEHQEVTARLEELLQRWKAAAPAEEPVPGSEAGAAERLESASADEVLDFIQN
ELGLS
selected fasta
>polyketide synthase [type I modular polyketide synthase]
GTGGCTGACCCGGTGAATTCACGGCAGGCGCCTCGGGCTGCGCGGACACCTGACCGGAGC
ACCGGACCGGTCGCCGTCGTCGGCATGGCCTGCCGCTTCCCCCAGGCGGACGGCCCCGGC
GCCTACTGGCGGCTGCTCAGCGAGGGCACCGACGCCGTCACCGAGGTGCCCGAGGCGCGG
CGCGCGGCCGTGCCCGAGGGCGCCGAAGGGGCGGGCGCGCGCGGCGGATTCCTGGACCGC
ATCGACGCCTTCGACGCCGCCTTCTTCGGGATCTCCCCGCGCGAGGCCGCCGCCATGGAC
CCCCAGCAGCGGCTCGTCCTCGAACTCGTCTGGGAGGCCCTGGAGGACGCGGGCACCCTT
CCCGGCGCCCTGAAGAACTCCGCCACCGGCGTCTACGTCGGCGCCATCTGGGACGACTAC
GCGGCCCTCGTCAAGCGCCACGGCGACCCCGCCGTCACCCAGCACACCTTCACCGGCCTC
AACCGCGGCGTCATCGCCAACCGCGTCTCCTACACCCTCGGCCTGCGCGGCCCCAGCCTC
ACCGTGGACACCGCGCAGTCCTCCTCCCTGGTCGCCGTCCACCTCGCCTGCCAGGCCCTG
CTCTCCGGCGAGGCCGACCTCGCTCTCGCCGGAGGCGTCAATCTCCTTATCGACCCGGCG
AGTTCGGAGATCACCGCCCGCTTCGGCGGGCTCTCCCCGAGCGGCCGCTGCCACACCTTC
GACGAGCGGGCCGACGGCTTCGTGCGCGGCGAGGGCGGCGGCGTCGTCGTCCTCAAGCCG
CTCGACGCCGCCCTCGCCGACGGCGACCGCGTGCATTGCGTGATCCTCGGCAGCGCCGTC
AACCACGACGGCGCCACCGACGGACTGACCGTGCCCAGCGCCGAGGCACAGACCGAGGTC
GTACGGCACGCCCTCGCGGCCGCGGGTCAGAGCCCCGACCAGGTGCAGTACGTCGAACTG
CACGGCACCGGCACCCCGGTCGGCGACCCCGTCGAGGCCACCGCCCTCGGCGCCGCCTTC
GAGGGACGCGGTGAGTCGGCCCCGGTCGCCGTGGGCTCCGCGAAGACCAATATCGGCCAT
CTGGAGGCCGCGGCCGGGATCGCCGGGCTGGTCAAGGCCGCCCTCGCGATCCGCCACCGC
GAACTGCCCCCGAGCCTGCACTTCCGCGCCGCCAACCCGGCCATCGACCTGCCCGCCCTC
GGCCTGCGCGTCCAGGACCGCAGGGGCCCCTGGCCCGCCCCCGAGCAGCCGCTGATCGCC
GGGGTCAGCTCCTTCGGACTCGGCGGCGCCAACGCCCATGTCGTCCTCGGCGAGGCCCCC
GCCCCGGCCGCCGCCCCCGAGCCGAAGGGCGCCACCGCCCCGGCCCGCCCCCTCCTTTTC
CCCGTCTCCGGCCGCGGTGACAAGGCCCTGCGCGCCCAGGCCGCCCGGCTCGCCGCGCAC
CTCGCCGCCGAGCCCGGCCACCCGCCCGCCGCCCTCGCCCGCGCGCTCGCCACCACCCGT
ACCGCGCACAAGGACCGCGCCGTCGTCCTCGGCCACCAGCTGCCCGAGCTGCTCGCCGGG
CTCGGCTCCCTCGCGGACGGCAACAGCAGCGCCCAGCTCGTCCAGGGCCGCGCCCTGCCC
GGGGCCACCGCCTTCCTCTTCACCGGCCAGGGCAGCCAGCGCCCCGGCATGGGCCGCGAA
CTGCACGCCGCGGAACCGGAGTTCGCCCGCGCCTTCGACGAGGTCTGCGCCGTACTCGAC
CCGCTGCTCGACCGCCCGCTGCGTGAGATCGCCTTCGCCGGGGCGGACAGCCCCGAGGCC
GCGCTGCTGGACCGCACCGCGTACACCCAGCCCGCCCTGTTCGCCTTCGAGGTCGCCCTG
TACCGGCTCCTCGAACACCTCGGCGCCCGCCCCGACTTCCTCGTCGGGCACTCCATCGGC
GAACTCGCCGCCGCCCATGTCGCCGGGGTGCTGAGCCTCGCCGACGCCGCCCGCCTGGTC
GCGGCCCGCGGCAGGCTGATGGACGCGCTCCCCGAGGGCGGCGCCATGGCCGCCCTGGAG
GCCACCGAGGAGGAACTCGCGCCGCTCCTCGACGAGCACGGCGGACGCCTGGACCTCGCC
GCGGTCAACGGGCCGCGCGCGGTCGTCGTCTCCGGCGACGCCGCCGCGGTCGACGAGGCC
GCCGCCCACTTCGCGGCCCAGGGCCGCAAGACCAAGCGGCTGCGCGTCAGCCATGCCTTC
CACTCCGCGCACATGGACGGCATGCTCGACGCATTCCGCGGCGTCGCCGAGGAGTTGACC
TACCGGCCCGCCACCCTGCCCATCGTCTCCAACCTCACCGGACAGCCCGTCGCGGACGAG
GAGATCGGCACCGCCGACTACTGGGTGCGCCACGTCCGGGGCGCCGTCCGCTTCGCCGAG
GGCATCGCCGCCCTGGAGGCCGCCGGAGTCACCCGCTACGTCGAGATCGGCCCCGACGGC
GCCCTGTCCTCGATGGGCCGCGAGTGCGCCGACCCCGAATCGGCCTTCGTCCCCGTCCAG
CGCGGCACCCGCACCCCCGAGGCCGAGGCCCTGACCGCCGCGCTCGCCCGGATGCACACC
GTCGGCATCGACCTGGACCCGGACGCGCTCTACGGGCCCGCCGAGCCGGGCCACATCGCC
CTGCCCACCTACGCCTTCCAGCGCCGCGGCCACTGGATCGACACCACCGGCACCGCCCGT
CCCGCCCCCGCCGCGCCCCGGGCCGCCGCCCCCGCCCCGGAGGCGATCGAGGAGGACCGG
CCCGGCTCCGCCCTGCGCGAGCGGCTCGGGGCCCTCTCCGCCGCCGAGCAGGACCGCAGC
CTGCACCGCCTGCTGCGCGAGCACATCGCCACCGTGCTGCGGCTCGACCCCACCGACGAG
ATCGACCTGCGCAGCACCTTCCACGAGCTGAGCTTCGACTCCTGGACCGCCGTCGAACTG
CGCGACGGGCTCTCCGCCGCCACCGGCCTCGCCCTGCCGAGCAGCCTGCTCTTCGACTAC
CCGACCCCGCTGGCGCTCGCCGGGTACCTGCGCGAACTCGCCCTCGGCGGCGGCGAGGAG
ACCGCCCTCGCCCCCACCGTGTCGGCCGGCGACGAGCCCATCGCCATCGTCGCCATGAGC
TGCCGCTTCCCCGGCGGCGTGGACACCCCCGAGCAGCTGTGGAGCGTGCTCGCCGAGGGC
CGCGACGTCATCGGCGCCTTCCCCACCGACCGCGGCTGGGACCTGGAGGGCCTCTACGAC
CCCGAGGGCACCCAGCCCGGCAAGCACTACGTCCGCGAGGGCGGCTTCCTCGGCGGCGCC
ACCCGCTTCGACCCCGCCTTCTTCGGCATCTCCCCGCGCGAGGCCACCTCCATGGACCCG
CAGCAGCGGCTCCTCCTGGAGACCTCCTGGGAGGCCGTGGAACGCGCCGGGATCGACCCG
GCCGCCCTCCGCGGCACCCAGACCGGCGTCTTCGTCGGCGCCACCTTCCAGGACTACGGG
CCCCGCCTGCACGAGGGCACGGAGACCACCGAGGGCTATCTGATGACCGGCAGCACGCCG
AGCGTCGCCTCCGGCCGCATCGCCTACACCCTCGGCCTGACCGGGCCCGCCGTCACCGTC
GACACCGCCTGCTCGGCCTCCCTGGTCGCCCTGCACCTGGCCGCCCAGTCCCTGCGGCAG
GGCGAGTGCTCCCTCGCCCTCGCGGGCGGTGTCACCGTCATGCCCACCCCCGGCATCTTC
GTCGAACTCACCCGCCAGCGCGCCCTGTCCGCCGACGGCCGCTGCAAGTCCTTCGCCGCC
TCCGCCGACGGCACCGGCTGGTCCGAGGGCGCGGGCGTCCTGCTCCTGGAGAAGCTCTCC
GACGCCCGCCGCCACGGCCACCAGGTCCTTGCCGTCATCCGGGGCTCGGCCACCAACCAG
GACGGCGCCTCCAACGGCCTGACCGCGCCCAACGGCCCCTCCCAGCAGCGCGTCATCCGC
CAGGCCCTGGCCAACGCGGGCGTCACCGCCGACTCCGTCGACGCGGTCGAGGCCCACGGC
ACCGGTACGAAGCTGGGCGACCCCATCGAGGCGCACGCCCTGCTCGCCACCTACGGCACC
CTGCGCGGCGAGAGCCTTCCGCTGCGCCTCGGCTCGCTGAAGTCGAACATCGGCCACACC
CAGCAGGCCGCCGGGGTCGCCGGCGTCATCAAGATGGTCCTCGCTCTCCAGAACGAGACC
CTGCCCCAGACCCTGCACGCCGCCGAACCCTCCCCGCACATCGACTGGTCCGCGGGCGCC
GTGGAGCTCCTGAACGCGCCCGCGCCCTGGCCGCGCGGCGAGCGCCCCCGCCGGGCCGGT
GTCTCCTCCTTCGGCATCAGCGGCACCAACGCCCACCTGATCCTCGAAGAGGCCCCGGCC
GAGGCCGAGTCGGCCCCTGCGCGGACTCCGGAGCAGGACCGGCCGCTGCCCTGGCTGCTC
TCCGCCCGCAGCGAGGAGGGCCTGCGCGTCCAGTCCGCCCGCCTCGCCGCCTTCGCCGCC
GATCAGCCCGACGCCCTCGCCCTGGCCTCCGCCCTCGCCACCTCCCGCACCGCCTTCGAG
TACCGCGCCGCCGCGATCGGCGACACCCACGCCGAACTCCTCACCGCCCTGGAACGCCCG
GCGGTCCGCGGATTTGCCGCCCCCCGCAACAAGACGGTGTTCGTCTTCCCGGGGCAGGGT
TCGCAGTGGGCCGGTATGGCGGTCGAACTCCTGGACTCCTCCCCGGTGTTCGCGGCCCGG
TTCGCCGAAGTCGCCTCTGCTGTAGAGGAGTACGTGGACTGGTCGGTGGAGTCGGTGGTC
CGGGGTGCGGACGGCACCCCGTCGCTCGACCGCATCGAGATCCTTCAGCCGGTGCTGTTC
ACGGTCATGGTGTCGCTGGCCGCGGTCTGGCAGTCGGTCGGGGTCACCCCGGACGCGGTG
GTCGGTCACTCGCAGGGCGAGATCGCGGCTGCTGCGGTCTCGGGTGCGTTGTCGCTTGAG
GATGCGGCTCAAGTGGTGGTGCTGCGTTCGCAGTTGTTCGCGGATGAGTTGGTCGGCAAG
GGTGCGGTGGCGTCGGTTTCCTTGCCTGCGGCTGAGGTCGAGGCGCGTATCGCGCGCTTC
AACGGTGACGCTGAGGTGTTGTCGATCGCGGGGAACAATGGTCCGCGTTCGGTGACGGTC
GCGGGTCAAGTGGCCGCTCTGGAAGAGCTGGTGGCCGAGTTGGAGGCCGAGGGTGTCCGG
GCGAAGGTGATCGGCTCCACGGTCGCTTCGCACTGCGCTCAGGTGGATCCGCTGCACGAG
CGGATCCTCGATCTGCTGTCGTTCGTGCAGCCGCGTGAGGGCTCCGTTCCGCTGTACTCG
ACGGTCAACGGCGAGGTGCTGAGCGGCGCCGAGTTGGATGCTTCGTACTGGTTCGAGAAC
TGCCGTCGTCCGGTGAGCTTCGAGCCGGTCGTACGTGCGCTGATCGCCGACGGTTTCGAT
GTGTTCGTGGAGTCGAGTGCGCACCCGGTGCTGACGTACGGCATCAGTGAGACCTCTGAC
GATGTGGGTGTGGAGGTGCTTGCGCAGGGGACGCTGCGGCGCCAAGAAGGCGGTCTCCGG
CGGGTGTTGACCTCCTTCGCCGAGGCCTGGACCCGTGGTGTCGCCCTCGACTGGACCGCG
GTGCTGCCGGAGCCGGTGCGTGATCTGGGGCCCGTGCTGCCCACCTACCCCTTCCAGCGC
GAGCGCTACTGGCTGGACATGGCCGACGCCTCCGCCGCCGATGTCGGCTCCGCCGGTCTC
CGCGCGCCGGGGCACCCGCTGCTCGGCGCCGCCGTGCGCCTCGCCGAGGGCGACCAGTAC
CTGCTGACCGGCCGGGTCTCCCTGAAGACGCACCCCTGGCTCGCCGACCACGGCGCCATG
GGGAGCGTGCTGCTCCCGGGCACCGCCTTCGTGGAGCTGGTGGTCCGCGCCGGGGACGAG
GCGGGCTGCGAGCACCTGGAGGAACTCACCCTGGAGGCACCGCTGCTGCTCCCGGAGCAC
TCCGGGGTGCAGCTCCAGGTCGGTGTCGGTCCCGCCGACGCCTCCGGGCGCCGCCAGGTC
TCCGTGCACTCCCGGGCCGAGGCCGAGGAGGCGGAGGAGACCTGGGTGCGGCACGCCCTG
GGCTTCCTCGCGCCCGCCGGTACCCACGGTCCCCAGACGCTGGAGGCCTGGCCGCCCGCC
GGGGCCGAGGCGCTGGACCTCGCCGACTTCTACGCCCGTACCGCCGAGGCCGGTTACGGC
TACGGGCCCGCCTTCCAGGGCCTGCACAAGGCCTGGGGAAGCGGCGAGGAGATCTTCGCC
GAGGTGGCGCTCGCGCCCGAACAGCGGGAGCAGGCAGCGGAGTTCGGGCTGCACCCCGCG
CTTCTGGACGCCGCCCTGCACGCCGAGCAGCTGCTGCGCGCCGCGCGCGGTGAGGACGCC
GGGGTCCGGCTGCCCTTCGTGTGGAGCGGGCTGACCCTGCACGCCGTCGGGGCCGCCGCG
CTGCGGCTGCGGATGACCTCGCTCGGCACCGACACGGTCTCCCTCCTGGTGACCGACACC
GAGGGCCGCCCGGTGGCCTCGGCCGACTCGCTCGTGCTGCGGCCGGTCGCCGCCGAGCAG
TTCACCGGCGGGGCCGCGCGCGAGGGGCTCTACCGCGTCGAGTGGTCGCCGGTGCCCGCG
GGCGGTGGCACGCCCGCCGACTGGGCCGAGATCGGCGGCAGCGCCTTCCCCGACCTCGCC
GCGCTCACCGCCGCCCTCGACGAGGGCATGGCCGTACCGCCGGTCGTGGTGGTCGCCCGC
GAGCCTGAGGAGGTCGCGGACCCGGGACTGCTCGCCGAGCGGGCCCGCGCGGCCACCGCC
GGGATGCTGGCCCTCGTACAGGACTGGCTGGCCGAGGACCGGTTCGCCGGGTCCCGGCTG
GCGGTCGTCACCCGCGGGGCCATGGCCGTACGCGCCGGGGAGGACGTCACCGACCTGGTG
CACGCGCCGCTGTGGGGACTGCTGCGCTCCGCCCAGTCCGAGAACCCGGACCGCTTCGTC
CTCCTCGACCGCGACCCCTGGGACAGCACCGGCGGCGATCTGCCCGCCGCGCTGGCCACC
GGCGAGTCCCAGCTCGCGGTGCGCGACAAGGCGCTGCTGGTGCCGCGGCTGTCCCGCAGC
GCCGGGCAGCCCGCCGCCCGCCCGCGCTGGAACCCCGAGGGCACCGTCCTGATCACCGGC
GGGACCGGCACCCTCGGCGCCCTCCTCGCCCACCACCTGGTCACCGAACACGGCGTCCGC
AGGCTCCTGTTGACGGGCCGCCGCGGACCCGAGGCGCCCGGCGCCGCCGCCCTGGCCGAC
TCGCTCGCCGCACTGGGCGCCGAGGCCGAGGTGGTCGCCTGCGACGCCGCCGACCGCGGG
GAACTGGCCGCGCTGCTCGACCGGATCCCCGAGGCCCACCCGCTCACCGGTGTCTTCCAC
GCGGCCGGGGTGCTCGACGACGGCATGGTCGGCGCGCTGAGCGCGGAACGCCTCGACGCG
GTGCTGCGGCCCAAGACCGACGCCGTCTGGCACCTGCACGAGCTGACCCGCGACCTCGAC
CTGACCGCCTTCGTGCTCTTCTCCTCCATCGCGGGCGTCTTCGGCAACCCCGGCCAGTCC
AACTACGCCGCCGCCAACGCCTTCATGGACGCGCTCGCCCACCGCCGCCACGCCGAGGGT
CTGCCCGCCTCCTCCCTGGCCTGGGGCCTGTGGCAGGAGGCCAGCGGTCTCCTCGCCCAC
CTGGAGGACGGCGACCTCGGCTGGATGAGCCGGGCCGGCATCCAGCCGCTCGCCTCCGAC
CACGGACTCGCCCTCCTCGACGCGGCGTTGCGCACCCCGGGCGAGGCCCTCCTCGTACCG
GTCAGCCTGAACACGGCGACCCTGCGCGGGCGCGCCGCCTCGGGACTGCTGCCCGGGCTC
TTCCGCCAACTGGTGCGGGTTCCGGCCCGGCGCACCGTCGAGACCGGCGCCGCCGAGGAC
GGGTCCTCCGCCCTGGTCCGGCGCCTCGCCGCGCTCGGCGAGGCCGAGCAGGAGCGCGAA
CTCACCGATCTGGTACGGGAGTCGGTGGCCGCCGTGCTCGGCCACGGCGACCCCGCGGCG
ATCAGCGCGGACCGGGCCTTCAAGGCGCTCGGCTTCGACTCGCTCACCGCGGTCGAGCTG
CGCAACCAGCTCGGCGCCGCCACCGGCATCCGGCTGCCCGCCACCCTGATCTTCGACCAC
CCCACGCTGACCGCGGCCGCCCGCTTCCTGCGCGGCGAACTCCTCGGCGCCGAGGCCGCG
GTGCCCGCCGAGCTGCCGGACACCCCGGTGCAGGGCGGCACCGGCGAGCCGATCGCGATC
GTCGCGATGGCCTGCCGCTACCCGGGCGGCGTCGCCTCGCCCGAGGACCTGTGGGAGCTG
GTCGCCGAGGGCCGGGACGCCGTCTCCGGCTTCCCCACCGACCGCGGCTGGGACCTGGAC
ACCCTCTTCGACCAGGACCCCGAGAAGCTCGGCACCAGCTATGCCCGCGAGGGCGGATTC
CTGTACGGCGCCGGGGACTTCGACCCCGAGCTGTTCGGGATCTCCCCGCGCGAGGCGCTG
GCGATGGACCCGCAGCAGCGGCTCCTCCTGGAGACCTCCTGGGAGCTCTTCGAACGCGCC
GGGCTCGGCCTGGACGCCGTACGCGGCAGCCGCACCGGCGTCTTCGCGGGCGCCATGCAC
CACGACTACGCCTTCCGGGTGGAGGAGAACGCCCAGCGGGTGGAGGGCTACGGCCTCACC
GGCACCCAGGGCAGCGTGGTCTCCGGCCGCGTCTCCTACGCCTTCGGCCTCCAGGGACCC
GCGGTCACCGTGGACACCGCCTGCTCCTCCTCGCTGGTCGCCATGCACCTGGCCGCGCAG
TCGCTGCGGCAGGGCGAGTGCCAGATGGCGCTCGCCGGGGGCGTCGCCGTGATGGCGACC
CCCGGGGTGTTCGTCGAGTTCAGCCGCCAGCGGGGCATGGCCGCCGACGGGCGCTGCAAG
TCCTTCGCCGCCGACGCGGACGGCACCGGCTGGGCGGAGGGCGTCGGCCTGGTCCTGCTC
GAACGCCTCTCCGACGCCCGCCGCAACGGCCACCAGGTCCTCGCCGTGCTGCGCGGCTCG
GCCACCAACCAGGACGGCGCCTCCAACGGCCTCACCGCGCCCAACGGCCCGGCCCAGCAG
CGCGTCATCCGGCAGGCCCTCGCCAACGCCCGCCTCGGCGCGGACGAGGTCGACGCGGTC
GAGGCGCACGGCACCGGCACCACCCTGGGCGACCCCATCGAGGCGGGGGCCCTGCTCGCC
ACCTACGGCAAGGAGCGCGCGGGGCGGTCCCCGCTGTGGCTCGGCTCGCTGAAGTCGAAC
ATCGGCCACGCCCAGGCCGCCGCCGGTGTCGCCGGGGTCATCAAGATGGTGCAGGCCATG
CGGCACGGGAAGCTGCCCCGCACCCTGCACGCCGAGGTGCCCACCCCCGAGGTCGACTGG
GAGTCCGGCGCCGTGCGGCTCCTGGACGAGGGCGTCGACTGGCCCGAGACCGGCCGCCCG
CGCCGCTCCGCCGTCTCCTCCTTCGGCATCAGCGGCACCAACGCCCATGTGGTCCTCGAA
GAGGCCCCGGCCGCGCCCGCCGCCGAGGCCCCCGCAGCCGGAACCGAGTCCGGAATGGCA
GCCGGGCTCGTCGCCTGGCCGCTCTCCGCCCGCGGCGAGCGCGCCCTGCGCGGCCAGGCC
GGGCGGCTCGCCGACTGGGCGGACGCGGGCACCGGTCTGTCCGCCACCGCCTCCGCACTG
GTGCACCGGCGCTCCGCCCTGGAGCACCGCGCCGTCGTCACCGCCGACTCGCTGGAGGGC
CAGCTCGCCGCACTGCGCGCGCTCGCCGCCGGTGAGGAGGCGCCGGGCCTGCGGCAGGGC
CAACTCCCTGCGACCCAGGGGCGGCTGGCCTTCCTCTTCTCCGGCCAGGGCGCCCAGCGC
GCCGGGATGGGCCGCGAACTGTACGCCGCCGAGCCGGTGTTCGCCGCCGCCTTCGACGAG
GTCTGCGCCGCCTTCGGCGAGGACCTGCGGGAGCGGATCTTCACCGCCCGGCAGGAGGAA
CTCGACCGCACCGGCACCACCCAGCCCGCCCTCTTCGCCATCGAGGTCGCGCTCTTCCGC
CTCGTCGAATCCCTGGGCGTACGGCCCGACTTCGTGGCCGGGCACTCCATCGGCGAGCTG
GCCGCCGCCCATGTCGCGGGCGTGCTCTCGCTGCCGGACGCCTGCCGCCTGGTCGCCGCG
CGCGGGCAGTTGATGGAGGCGCTGCCCGAGGGTGGCGCGATGGTCTCGGTGCGCGCCACC
GAGGACGAAGTACGCGCGCACCTCGCGGAGTTCACCGGCCGGGTGGACGTCGCCGCGGTC
AACGGCCCCGAGTCCGTGGTCCTCTCCGGTGAGGAGGCGGCGGTCGAGGAGATCGCCGGA
CGCCTCGCCGAGGCGGGCCGCAAGACCCGGCGGCTGCGCGTCTCGCACGCCTTCCACTCC
CCGCTGATGGAACCCATGCTGGACGCGTTCCGGCGGGTGGCCGAGGAGTTGACGTACCAG
GCGCCCTCGGTCCCCGTGGTCTCGAATCTGACGGGTGAACAGGTCACCGCCTTCGACGCG
GCGTACTGGGTGGAGCATGTGCGCCGCGCGGTCCGCTTCGCCGACGGCATCGGCTTCCTC
GCCTCCCGCGGCGTGACCCGCTTCGTCGAGCTGGGCCCCGACGGTGTGCTCACCGCGATG
GCGCAGGAGACCCTGACGGACCCCGAGACCCTGCTGCTGCCCGTCCTGCGCAAGGACCGC
CCGGAGCCGGAGGCCTTCCTCGACGCCCTCGCCCAGGCCTGGACCCGCGGCGTGGACGTC
GACTGGGCCGCCCGCTACGGGCCGGAGCAGAGCACCGGGGTCAGCCTGCCGACGTACGCC
TTCCAGCACGAGCGCTACTGGCTGGCGCCGGTCGCCGGGGCCTCGGACGCCGCCGGACTG
GGGCTGGCCGCCGCCGGGCACCCGCTGCTCGGCGCCGCCGTGCACCTCGCGGACGGCCAG
GGCCTGGTGCTCACCGGCCGGGTCGCGGCGGGGACCCGGCCCTGGCTCGCCGACCACGCG
GTCGGCGGCAGTGTGCTCCTGCCGGGCACCGCCTTCGTCGGCCTCGCGCTGCGCGCCGGG
GAGGAGGCCGGACTCGGCCGCCTGGCCGAACTCACCCTGGAGGCACCGCTGGTGCTGCCC
GCGCAGGGCGCCGTACAGCTCCAGGTCGTGGTCGGCACCGGCCCCGAAGGGGAGGCGGCG
GACACCCGCGGTGTCGAGATCCACGCCCGCCCCGAGAACGGCCAGGGCACCTGGACCCGG
CACGCCAGCGGCACCCTCGCCCCGCAGGGCCCGGCCCCGGCCGCCGAGGCTGCCGCCTGG
CCGCCCGCGGGCGCCGAGGCGGTCCCGCTGGACGGCTTCTACGAGCGGCTCGCCGACTCC
GGCTACGGCTACGGCCCTGCCTTCCAGGGCCTCAAGGCGGCCTGGCGGGACGGCGAGGAC
CTCTGTGCGGAGGTGGCGCTCGCCCCCGAACAGCAGGAGGAGGCAGCCGAGTTCGGGCTG
CACCCCGCGCTGCTCGACGCCGCCCTGCACCCCGTGCTGCTCGGCCTCGCCGAGTCCGGC
GCGGGGGAGGTGAAGCTGCCCTTCGCCTGGAGCGGGGTCAGCCTGCACGCCGAGGGCGCG
AGCGCCCTGCGGGTGCGGATGCGCGGCGCCGCCGAGGGCAGTGTCTCGGTCACGCTCACC
GACACCACCGGACTGCCGGTCGCCGAGATCGACTCGCTGACCCTGCTGCCGGTGCCCGCC
GGGCAGTTGGGGGCCGCTCCCGCGCAGGAGGGCCTCTTCCGGCTCGACTGGACGCAGGTC
ACGGCCGACCACGAGCCCGAGCGCGACTGGGCGGTACTCGGCGAGCAGCTGCCCGCCGCG
CACCGCACCGACGGCTCGCCCGTCTACGCCGATGTGGCGGAACTCCTCGCGGCGGCCCGC
GGCGAGGCCGGCGCCCCCGCGGCCGTCCTGCTGCCGGTGCCCCGCGCGGAGAACGGGGTC
ACCGCCGAGGCGGTCCACACCGAGAGCGCGCGCCTGCTCGCCGTCCTCCAGGCCTGGCTC
GCCGAGGAACTCCTCGAAGGCACCAAGCTCGTCGTCCTCACCCACGGCGCCGTCGCCGCC
CGACACGGCGAGGACGTCGGTGACTTGACGCATGCCGCGCTCTGGGGCCTGGTGCGCAGC
GCGCAGACCGAGAACCCGGGCCGCTTCGTCCTGGTCGACACCGACCTGAGCGCGGCGAGC
GCCGCCGAGGGCGCCGAGAACACCGCCGAGGACCTGTCCGTGCTCGCGGCGGTCGCCACC
GGGGAGGACCAGATCGCGGTCCGCGAGGGCCGCTTCCTCACCCCGAGGCTGGCCCGCGGC
GGCAGCGGCGAACTCCTCACCCCGCCCGCGGACGCCCCGAGTTGGCGGCTCGACACCACC
GGCGGCGGCACCCTGGAGAGCCTGTCCCTGGTGCCGCACGAGGAGGCCCTGCGGCCGCTC
GCCGCGGGCGAGGTCCGCGTCTCGGTACGGGCCACCGGCCTCAACTTCCGCGATGTCCTG
ATGGCGCTCGGCATGTACCCGGACAAGATCGTGCTCGGCAGCGAGGCCGCCGGTGTGGTC
ACCGAGACCGGCCCCGGGGTGAGCCGACTCGCCGTGGGGGACCGGGTGATGGGCATGATC
CCGCACTCCTTCGGCCAACTCGCCGTCGCGGACGCCCGGATGCTCGCCCCGATGCCGGGC
GGCTGGTCCTTCGAGCAGGCCGCCTCGGTGCCCGCGGTCTTCCTCACCGCCTACTACGCA
CTGGTCGACCTCGCCGGACTCGGCGCGAGGGAACGCGTGCTGATCCACGCGGCGGCGGGC
GGCGTCGGCATGGCCGCGGTGCAACTGGCCCGCCACCTGGGCGCCGAGGTCTTCGGCACC
GCCAGCGAGGGCAAGTGGGACACCCTGCGCGACCTGATGGGCTTCGGCGGCGCCCACTAC
GGATCCTCCCGCTCCAGCACCTTCGAGGAGCGCTTCCGCACCGCCACCGGCGGCGAGGGC
ATGGACGTGGTCCTGGACTGCCTGGCCGGTGAACTCGTGGACGCCTCCCTGCGGTTGCTG
CCGCGCGGCGGACGCTTCGTCGAGATGGGCAAGACCGACATCCGCGAGCCCGAGCAGGTC
GCCCGCGACTACCCGGGCGTCCGCTACCAGGCCTTCGACCTGATGGAGGCCGGTCCGGAC
CGTATCGGGGAGATGCTGGCGGAGCTCGCCGGGTTGTTCGAGGCGGGGGTGCTGAAGCCG
CTGCCGGTGCGGTCGTGGGACATCCGGCGTGCGGGGGAGGCGTTCCGGTTCATGTCGCAG
GCGCGGCATGTGGGCAAGATCGTGCTGACGGTTCCGCAGGTCTGGGATCCGTCGGGGACG
GTCTTGGTGACCGGTGGTACGGGTACGTTGGGTGCGTTGGTGGCCCGGCATCTGGTGGTC
GAGCACGGGGTGCGGCATCTGGTGCTGGCGGCGCGTCGTGGTCCTGAGGCGCCGGGTGCG
GCCGAACTCGTGGCGGAACTGGGCGGGTTGGGCGCGCAGGCCGAAGTGGTGGCCTGTGAC
GCTGCCGATCGCGGGCAGCTGGCGAAGCTGCTCGACGGGATCGGCGCGGCACATCCGCTG
CGTGCGGTGGTGCACACCGCCGGAGTCCTCGACGACGGAGTCCTCGCCGCCCAGAGCCCC
GAACGCCTCTCCCGGGTCCTGCGGCCGAAGGCCGACGCCGCCTGGCATCTGCACGAGCTG
ACCCGCGATGTGGACCTGACCGCCTTCGTCCTCTACTCCTCGGCCGCCGGAGTCCTCGGC
AACGCCGGGCAGTCCAACTACGCGGCGGGCAACACCTTCCTGGACGCCCTCGCCGCGCAC
CGCCGCGCCCAGGGACTGCCGGGCGTCTCGCTCGCCTGGGGCCACTGGGCCCAGTCCAGC
GAGATGACCGCGGGGCTCGGCTCCGCCGACCTCGCCCGGCTCGGCCGCTCCGGCTTCCTG
CCGATGTCCGACGCGGAGGGCCTGCGGCTCTTCGACGCCGCGGTGGCCGGGGACGAGGCG
CTGCTCGCACCCGTACCGCTCGACCTCGCCGCCCTCAGGGCCCGCGGACGTACCGGCGAA
CTCCCCGGCGTCTTCCGGGGGTTGGTCCGTACGACGGTACGGCGGACGGTCTCGGCCGCC
GCCGCGGGCGCGACCGAGATCCCGCTCGCCGAGCGGCTCGCGGCGCTGCCGGAGGGCGAA
CGCGAGCACACGCTCCTGGAGTTGGTGCGCGCCAATGTCGCCACCGTCCTCGGGCACGGC
GTGCCCGCCGCGATCGGCGCCGACCGCACCTTCAAGGAGCTGGGCTTCGACTCGCTGACC
GCCGTCGAGTTCCGCAACCGGCTCGGCGCGGCCACCGGCCTGCGGCTGCCCCCGACGCTC
ATCTTCGACTACCCGACCACCGTCACCCTCGCCGGTCATCTGCTCGGCGAACTGGTGCCG
GCGGCCGCCCCGGACACCCCGGCCGACCTCCTCGGCGAACTCCAGCGGTTCGAGAACGCC
GTCCTCGGCGCCGACCCCGCCGACGGCGAGCACCAGGAGGTCACCGCCCGCCTGGAGGAA
CTGCTCCAGCGGTGGAAGGCCGCCGCACCCGCCGAGGAGCCCGTACCGGGGAGCGAGGCA
GGCGCCGCCGAGCGGCTCGAATCCGCCTCCGCGGACGAGGTACTCGACTTCATCCAGAAC
GAACTCGGGCTCTCCTGA
[0] KSQ23..388
[0] AT545..864
[0] malonyl-CoA738..742
[0] ACP941..1011
[1] KS1031..1407
[1] AT1553..1875
[1] ethylmalonyl-CoA1748..1752
[1] DH1925..2088
[1] KR2394..2574
[1] ACP2681..2751
[2] KS2776..3151
[2] AT3311..3620
[2] malonyl-CoA3496..3500
[2] DH3667..3831
[2] ER4163..4469
[2] KR4479..4659
[2] ACP4765..4835
[0] KSQ67..1164
[0] AT1633..2592
[0] malonyl-CoA2212..2226
[0] ACP2821..3033
[1] KS3091..4221
[1] AT4657..5625
[1] ethylmalonyl-CoA5242..5256
[1] DH5773..6264
[1] KR7180..7722
[1] ACP8041..8253
[2] KS8326..9453
[2] AT9931..10860
[2] malonyl-CoA10486..10500
[2] DH10999..11493
[2] ER12487..13407
[2] KR13435..13977
[2] ACP14293..14505

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [736-833]  2.4e-72 G3DSA:3.40.366.10 [1747-1864]  7.2e-67 G3DSA:3.40.366.10 [3496-3609]  7.7e-80 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR006162 Phosphopantetheine attachment site (PTM)
 [2709-2724]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [940-1013]  1.2e-15 G3DSA:1.10.1200.10 [2679-2754]  2.3e-21 G3DSA:1.10.1200.10 [4764-4838]  4.8e-19 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [941-1011]  17.424 PS50075 [2681-2751]  20.937 PS50075 [4765-4835]  19.842 PS50075
PS50075   ACP_DOMAIN
 [934-1048]  7.6e-26 SSF47336 [2674-2792]  3.2e-28 SSF47336 [4757-4849]  1.8e-21 SSF47336
SSF47336   ACP-like
 [944-1010]  4.9e-10 PF00550 [2684-2750]  1.8e-12 PF00550 [4768-4834]  4.4e-12 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [4152-4308]  3.1e-33 SSF50129
SSF50129   GroES-like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [4183-4238]  6.5e-09 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [2394-2573]  8.5e-65 PF08659 [4479-4658]  8.8e-63 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [23-264]  9.6e-84 PF00109 [1031-1282]  3.5e-97 PF00109 [2776-3026]  1.9e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [273-388]  7.9e-41 PF02801 [1290-1407]  3.7e-44 PF02801 [3034-3151]  3.7e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [545-864]  3.3e-61 PF00698 [1553-1875]  6e-90 PF00698 [3311-3620]  5.1e-68 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [542-837]  1.2e-68 SSF52151 [1551-1857]  1.2e-63 SSF52151 [3308-3614]  1e-76 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [672-737]  2.8e-19 SSF55048 [1679-1747]  3.1e-12 SSF55048 [3430-3495]  7e-20 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [23-275]  3.5e-91 G3DSA:3.40.47.10 [277-441]  9.7e-59 G3DSA:3.40.47.10 [1034-1294]  2.3e-93 G3DSA:3.40.47.10 [1295-1461]  1.4e-62 G3DSA:3.40.47.10 [2776-3036]  2.2e-86 G3DSA:3.40.47.10 [3038-3204]  2.2e-60 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [14-387]  9.3e-90 SSF53901 [1024-1396]  3.4e-101 SSF53901 [2768-3150]  7.2e-97 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2637-2638]  7e-37 G3DSA:3.40.50.720 [4253-4443]  1.6e-49 G3DSA:3.40.50.720 [4480-4663]  9e-32 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1195-1211]  PS00606 [2939-2955]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [546-858]  6.4e-123 SM00827 [1555-1856]  7.8e-97 SM00827 [3312-3600]  7.2e-122 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [942-1014]  7.2e-20 SM00823 [2682-2754]  2e-32 SM00823 [4766-4838]  4.4e-32 SM00823
SM00823   Phosphopantetheine attachment site
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [1925-2088]  5.5e-81 SM00826 [3667-3831]  7.4e-77 SM00826
SM00826   no description
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [24-441]  1.4e-196 SM00825 [1034-1460]  8.6e-225 SM00825 [2778-3204]  3e-221 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2394-2574]  8e-67 SM00822 [4479-4659]  4.4e-59 SM00822
SM00822   no description
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [4163-4469]  2.6e-186 SM00829
SM00829   Enoylreductase
SignalP No significant hit
TMHMM No significant hit