close all open/close all

CDS information : Salino_00920


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction117,804 / 129,557 / + [in whole cluster]
117,804 / 129,557 / + [in contig]
Location117804..129557 [in whole cluster]
117804..129557 [in contig]
TypeCDS
Length11,754 bp (3,917 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I modular polyketide synthase
Gene
Gene (GenBank)salAII
EC number
Keyword
Note
Note (GenBank)
  • Polyketide synthase domains: KS, AT, KR, DH, ACP,KS, AT, KR, ER, DH, ACP
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Related Reference
ACC
H6D570
NITE
Salino3_00140
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)

close this sectionPKS/NRPS Module

3 methylmalonyl-CoA
4 malonyl-CoA
KS34..409
AT570..887
DH937..1102
KR1398..1578
ACP1683..1753
KS1775..2151
AT2307..2617
DH2664..2828
ER3153..3459
KR3469..3649
ACP3756..3826

close this sectionSequence

selected fasta
>polyketide synthase [type I modular polyketide synthase]
MANEDKLVESLKRVAAELHDTRQRLTEAENRTGEPIALVGMACRYPGGVRSPEDLWELVS
EGRDAISGFPDDRGWDLERLYHPDPDNPGTAYTRSGGFLHDATDFDPGLFGISPREALAM
DPQQRILMETSWEALERAGLDPLSLKGSQTGVYVGAATPAYIVGGHTQQGAEGYSLTGTS
GSVVSGRLSYHYGFEGPAVTVDTACSSSLVALHWACQALRAGECSMALAGGVSVMSVPGL
FVEFSRQRGLSEDGRCKAFAQCADGTGWGEGVGVLVLERLSDARRNGHRVLAVVRGSATN
QDGASNGLAAPNGPSQQRVIRQALAHARLRPRDVDVVEAHGTGTTLGDPIEAQAVLATYG
KERPAEQPLWLGSLKTNIGHTAAAAGIAGVIKMTMALRKGVLPKTLHIDAPTPHVDWSAG
AVELLTDNQDWPALDRPRRAAVSAFGISGTNAHLILEQAAESDERRPAPEAPALPPFAAD
TAVAWPLAGHSTEAVRGQAARVHAHGTAHPETTAAALGLGLATTRSALPYRAVSLGAATG
EHLDTLRRLADGQSAAHLVEGLADIEGKTTFVFPGQGSQWPGMAVELLDSSPAFAARMAE
CDKALAPHADWRLLDVLRGAEGAPGFDRVDVVQPVLWAVMVSLAALWRACGVEPDAVVGH
SQGEIAAAVVAGALSLEDGAKVSALRAKALLALAGKGGMMSVAEPAEAVRARLTPFGERI
SLAAVNGPSSTVVSGEPEALAELRAACEADGVRARLVNVDYASHGPQVESIRTAVLGALA
GITPRKATVPFLSTVTGKAAEGTELDAEYWYTNLRGTVRFEDGIRALLERGHGFFLEASA
HPVLTVGVQETIEAAGLPAVALGTLRREEGGPRRFLASLSEAWVRGRTPDWSAVFSGHAV
TAPELPTYAFQRKRYWADPVGAAAGDVAAAGLGAVDHPLLGATVRVADGDEFLLTGRLSL
QSHPWLADHAVSGTVLLPGTAFVELALRAGDEAGCAQLSELTLEAPLLLPAQGGVQIQLV
VGEPKEDGRRSLGIYARPAEDDQPDTPWTRHAVGFLTPEPPAAAPEPLTVWPPAGAEPLA
LDDFYARATESGYGYGPVFQGLKAAWQLGGETWAEVALPEQQREDAEEFGLHPALLDAAL
HATLLGADDGAADGVRLPFAWSGVSLRAVGAASLRVRLAPTADGELSVSLYDSAGAPLAE
VAALGLLPVSAEQLRGTTGAESLHRVEWTTLAPGAEAAPDPDRRELPALRAALDAGEAAP
AHVLVELTPEDGADSPALAAHTATRRTLALLRDWFAEERLTASRLVLLTRGAVRTAPGEG
PADLALAAVRGLVHSAQTENPDRIQLLDTDGTEASTAVLHRALLSEEPELALREGEFRAP
RLVRTAPGGEGSEWDPEGTVLITGGTGALGALLARHLVTRHGVRHLLLTGRRGLDTPGAA
ELVAELAESGARTAVAACDAADREQLASLLATVPADRPLRAVVHAAGVLDDATTATLSEE
QLTRVLRPKADAAWHLHELTRELDLTAFVLFSSAAGAFGNPGQGNYAAANSFLDALADHR
RAEGLPAVSLAYGLWQSEGMPGHLDSAELGWSARAGYLPLRPEQGLAALDAADSHRGEPL
LVTVPLDKAVLRARAASGVLPHLFRSLVRVPSRRAVENGAQGTGSALADRLATLDPEARQ
AELLDLVRGLVAAVLGHDEPEAIEPDKAFKELGFDSLTAVELRNRLAAATGLKLPATLVF
DHPSPGALARHLLTALLATGGPAATAPAATATGSDEPIAIVAMACRYPGGVSTPEELWQL
VAEGRDAVSGFPEDRGWDLEGLYDPEGNRPGSSYTRSGGFLYDAADFDPELFGISPREAV
TMDPQQRLLLETTWEAFERAGLDPLGLQGSRTGVFAGVMYHDYASHVEQAADSAEGYLLT
GTSGSVISGRLSYAFGLEGPSVSVDTACSSSLVAMHLAAQALRAGECSLALAGGVTVMAT
PNVFVEFSRQRGLSSDGRCKSFSATADGTGWAEGAGVLLLERLSDAERNGHRVLAVMRGS
AVNQDGASNGLTAPNGPSQQRVIEQALAGARLTPAEVDAVEAHGTGTTLGDPIEAQALLA
TYGQQRESDRPLWLGSIKSNMGHAQAAAGVAGVIKMVQAMRHGILPKTLHAEEPSPHIDW
SEGAVALLTEATPWPETGRPRRAGVSSFGASGTNAHVVLEAAPEPAETAEAAEDSAAGPY
LWPLSGRGESALRAQAARLHAHVSARPALRPADVTLSLTTGRPALEHRAAVTAADREGLL
TALAALAEGTRAPGLTQSSPRGGKLAFLFSGQGAQRLGMGRELYAVQPVFAAAFDEVCAG
FGADFRERVFAAEGGELDRTGLTQPALFAIEVALFRLVESFGVRADFLAGHSIGELAAAH
VAGVLSLEDACTLVAARGRLMEALPAGGAMVSIRAAEVEVRSRIGEFEGRVDIAAVNGPE
SVVVSGEEAAVLELAEALAESGHKTKRLRVSHAFHSPLMEPMLEEFRRVASGLAYGSPSI
PVVSNLTGELVTAFDAAYWVEHVRHAVRFADAIGFLAAEGVTRFVELGPDGVLSAMARDC
LPETFDGLLVPVLRKDRPEAETFLAALGEAWTKGIRPDWAALTAGQAARPVELPTYAFQR
LRYWPKPARPAGDVAAAGLGAAGHPLLGATVAAADGGQILLTGRLSLSSHPWLADHAVAG
TVLLPGTAFVELALRAGEEAGVPHLAELVLEAPLVLPARQAVQIQVLVGPAEEDGGRAVS
VHSRAGAPGESDALWVRNAAGRLTHPAPEAPAEPGNWPPAGAEPVDLDGFYAGLAAAGYG
YGPAFQGLAKAWRSGDGDQVFAEVELPESQQDEAGRFALHPALLDAALHGLAAAGPATAE
GQVRLPFSWNGVRLHAVGASRLRVRMATAGPDSLSLDIADPEGHPVLGVESLATRAVPVE
QLAAAATASTTEHLYRLDWSAVPAASAAEPPHLLRIGAGDAPGAPYRASHPDVAALTAAL
DADATPPGAVVLDVPGATASGAEAARETAAAVLGVLQEWLAAEQLADVRLFVRTRRAVAV
RSGEDVTALAQSPVWGLVRAAQAENPGRLVLVDTDADWDTPLPEAVFAAAEEPQLAVREG
ALLAPRLVRGSAPGAAPALPAGGAWTLDTTGGETLEDLAFLPCEADRIPLAEGEIRVAVR
AAGLNFRDVLIALGMYPGAARMGNEGAGIVTEIGPGVTGLAVGDRVTGLIRGAFGPLAVV
DRRLVVRVPEGLSFEQAAALPTVFLTAYYGLVDLAGLRRGEKVLVHAAAGGVGMAAVQLA
EHLGAEVFGTASEGKWDTLRALGLDERHLASSRTAAFEETFSAATGGEGVDVVLDCLAGE
LVDASLRLLPRGGRFLEMGKTDVRDPAEIAASYPGVDYRAFDMVEGAGPDRIGEMLAELA
ELFEAGVLKPLPVRSWDIRRAGEAFRFMSQARHVGKIVLTVPQVWDPSGTVLVTGGTGTL
GALVARHLVVEHGVRHLVLAARRGPEAPGAAELVAELGELGAQAEVVACDAADRGQLAKL
LDGIDGARPLRAVVHTAGVLDDAVLAAQTPQKLDRAMRPKVDAALNLHELTRDLDLTAFV
LYSSVAGVLGGPGQSNYAAANAFLDALAAHRRAQGLPGVSLAWGQWAEASGMTEGLAGAD
LARMNRSGVLPLPSEQGLALFDESARHDEPLLAAVRLDAAALRNQAEAGRLPAPLRGLVR
TAVRRAAAGTAATAAGAAALGQRLATLAEPERADALLDLVRGHVATVIAHPDPAAIDTER
GFLDLGFDSLTAVELRNGLGAATGLRLPTTLIFDYPSPAALAGHLLAELRPEGGEDGAAD
TAVLGAMSEWEAAIAALPAGSEGREKAVKRLRSLLWKFDRTENETDEEAQGQEGGSTLTA
ATDDEMFALIENELGLN
selected fasta
>polyketide synthase [type I modular polyketide synthase]
ATGGCGAACGAGGACAAGCTTGTCGAGTCCCTCAAGCGGGTTGCCGCCGAACTGCACGAC
ACCCGGCAGCGCCTCACCGAGGCCGAGAACCGCACCGGCGAGCCCATCGCCCTGGTCGGC
ATGGCCTGCCGCTACCCCGGCGGGGTGCGCTCGCCCGAGGACCTGTGGGAGCTGGTCTCC
GAGGGCCGGGACGCCATCTCCGGCTTCCCCGACGACCGCGGCTGGGACCTGGAGCGGCTC
TACCACCCGGACCCGGACAACCCGGGCACCGCCTACACCCGCTCCGGCGGCTTCCTCCAC
GACGCCACCGACTTCGACCCCGGCCTCTTCGGGATCTCCCCGCGCGAGGCCCTCGCCATG
GACCCGCAGCAGCGGATCCTGATGGAGACCTCCTGGGAGGCCCTGGAGCGCGCGGGCCTC
GACCCCCTCTCCCTCAAGGGCAGCCAGACCGGCGTCTACGTGGGCGCCGCGACCCCCGCC
TACATCGTCGGCGGCCACACCCAGCAGGGCGCCGAGGGCTACTCCCTGACCGGCACCTCC
GGCAGCGTGGTCTCCGGGCGGCTGTCCTACCACTACGGATTCGAGGGCCCGGCGGTCACC
GTCGACACGGCCTGCTCCTCCTCCCTGGTCGCCCTGCACTGGGCCTGCCAGGCGCTGCGC
GCGGGCGAGTGCTCGATGGCGCTCGCGGGCGGCGTCAGCGTGATGTCCGTACCCGGCCTG
TTCGTCGAGTTCAGCCGCCAGCGCGGGCTCTCCGAGGACGGCCGCTGCAAGGCCTTCGCC
CAGTGCGCGGACGGCACCGGCTGGGGCGAGGGCGTCGGCGTCCTCGTCCTGGAACGCCTC
TCCGACGCCCGCCGCAACGGCCACCGGGTGCTCGCGGTCGTCCGCGGCTCGGCCACCAAC
CAGGACGGCGCCTCCAACGGCCTCGCCGCCCCCAACGGCCCCTCCCAGCAGCGCGTCATC
CGCCAGGCCCTCGCGCACGCGCGGCTGCGGCCCCGCGACGTCGACGTGGTCGAGGCGCAC
GGCACCGGCACCACCCTCGGCGACCCCATCGAGGCGCAGGCCGTCCTCGCCACCTACGGC
AAGGAGCGCCCGGCGGAGCAGCCGCTGTGGCTCGGCTCCCTGAAGACCAACATCGGGCAC
ACCGCGGCGGCGGCCGGTATCGCGGGCGTCATCAAGATGACCATGGCCCTGCGCAAGGGC
GTGCTGCCCAAGACCCTGCACATCGACGCGCCCACCCCGCACGTCGACTGGTCCGCGGGC
GCGGTGGAACTCCTCACCGACAACCAGGACTGGCCCGCCCTCGACCGGCCCCGGCGCGCC
GCCGTCTCCGCCTTCGGCATCAGCGGCACCAACGCCCACCTCATCCTCGAACAGGCCGCC
GAGTCCGACGAGCGGCGGCCCGCGCCCGAGGCGCCGGCGCTGCCGCCCTTCGCCGCGGAC
ACCGCGGTGGCCTGGCCGCTCGCCGGGCACAGCACCGAGGCCGTCCGCGGCCAGGCCGCC
CGCGTCCACGCCCACGGCACCGCCCACCCCGAGACCACGGCGGCCGCCCTCGGGCTCGGC
CTCGCCACCACCCGCTCCGCGCTCCCGTACCGCGCGGTCTCGCTCGGCGCGGCCACCGGC
GAGCACCTCGACACCCTGCGGCGCCTCGCCGACGGGCAGAGCGCCGCCCACCTCGTCGAG
GGCCTCGCCGACATCGAGGGCAAGACCACCTTCGTCTTCCCCGGCCAGGGCTCCCAGTGG
CCCGGCATGGCCGTCGAACTCCTCGACAGCTCACCGGCGTTCGCCGCCCGGATGGCCGAG
TGCGACAAGGCGCTCGCCCCCCACGCCGACTGGCGCCTGCTCGATGTGCTGCGCGGCGCC
GAGGGCGCGCCCGGCTTCGACCGGGTCGACGTCGTCCAGCCCGTGCTGTGGGCCGTGATG
GTCTCCCTCGCCGCCCTGTGGCGCGCCTGCGGGGTCGAGCCCGACGCGGTCGTCGGCCAC
TCCCAGGGCGAGATCGCCGCGGCCGTGGTCGCCGGCGCCCTCTCCCTGGAGGACGGCGCC
AAGGTCTCCGCCCTGCGCGCCAAGGCGCTGCTCGCGCTCGCGGGCAAGGGCGGCATGATG
TCCGTCGCCGAGCCCGCCGAGGCGGTACGCGCCCGGCTCACCCCCTTCGGCGAGCGCATC
TCGCTGGCCGCGGTCAACGGCCCCTCCTCCACCGTGGTCTCCGGCGAGCCCGAGGCCCTG
GCCGAACTCCGCGCCGCCTGCGAGGCGGACGGCGTCCGCGCCCGCCTGGTCAACGTGGAC
TACGCCTCCCACGGCCCCCAGGTCGAGTCCATCCGCACGGCGGTGCTCGGCGCCCTCGCG
GGCATCACCCCGCGCAAGGCCACCGTGCCCTTCCTGTCCACCGTGACCGGCAAGGCCGCC
GAGGGCACCGAACTCGACGCCGAGTACTGGTACACCAACCTGCGCGGCACCGTCCGCTTC
GAGGACGGCATCCGCGCCCTCCTGGAGCGCGGCCACGGCTTCTTCCTGGAGGCCAGCGCG
CACCCCGTGCTCACCGTCGGCGTCCAGGAGACCATCGAGGCCGCCGGGCTGCCCGCGGTC
GCCCTCGGCACCCTGCGCCGCGAGGAGGGCGGCCCGCGCCGCTTCCTCGCCTCCCTCTCC
GAGGCCTGGGTGCGCGGCCGTACCCCCGACTGGTCCGCCGTCTTCTCCGGCCACGCGGTC
ACCGCCCCCGAACTGCCCACCTACGCCTTCCAGCGCAAGCGCTACTGGGCCGACCCGGTG
GGCGCCGCCGCGGGCGATGTCGCCGCCGCCGGTCTGGGCGCGGTCGACCACCCGCTGCTC
GGCGCCACCGTACGGGTCGCCGACGGCGACGAGTTCCTGCTCACCGGGCGGCTCTCGCTG
CAGAGCCACCCCTGGCTCGCCGACCACGCCGTCAGCGGCACCGTCCTGCTGCCGGGCACC
GCCTTCGTCGAACTCGCCCTGCGCGCCGGGGACGAGGCGGGCTGCGCCCAGCTCTCCGAA
CTGACCCTGGAAGCACCCCTGCTGCTGCCCGCCCAGGGCGGCGTGCAGATCCAGCTCGTG
GTCGGGGAGCCCAAGGAGGACGGCAGGCGCAGCCTCGGCATCTACGCCCGGCCCGCCGAG
GACGACCAGCCGGACACCCCCTGGACCCGGCACGCCGTCGGCTTCCTCACCCCCGAGCCG
CCCGCCGCCGCCCCCGAGCCGCTCACCGTCTGGCCGCCCGCCGGAGCCGAGCCGCTCGCC
CTCGACGACTTCTACGCCCGCGCCACCGAGTCCGGCTACGGCTACGGCCCCGTCTTCCAG
GGCCTGAAGGCCGCCTGGCAGCTCGGCGGCGAGACCTGGGCCGAGGTCGCCCTGCCCGAG
CAACAGCGCGAGGACGCCGAGGAGTTCGGCCTGCACCCGGCCCTGCTCGACGCCGCCCTG
CACGCCACCTTGCTCGGCGCCGACGACGGGGCGGCGGACGGCGTCCGGCTGCCCTTCGCC
TGGAGCGGGGTCAGCCTGCGCGCCGTCGGCGCCGCCTCCCTGCGGGTACGCCTCGCCCCC
ACCGCCGACGGCGAACTCTCCGTCAGCCTCTACGACTCCGCCGGCGCGCCCCTCGCCGAG
GTCGCCGCCCTCGGCCTGCTGCCGGTCTCCGCGGAGCAACTGCGCGGCACCACCGGCGCC
GAGAGCCTGCACCGCGTCGAGTGGACCACCCTCGCCCCCGGCGCCGAGGCCGCCCCGGAC
CCCGACCGGCGCGAACTGCCCGCGCTGCGGGCCGCGTTGGACGCCGGTGAAGCGGCCCCG
GCACACGTCCTGGTGGAGCTCACCCCCGAGGACGGCGCGGACTCCCCGGCCCTCGCCGCC
CACACGGCCACCCGCCGGACGCTCGCCCTGCTGCGCGACTGGTTCGCCGAGGAGCGCCTC
ACCGCCTCCCGCCTGGTGCTGCTCACCCGGGGCGCCGTCCGTACCGCCCCCGGCGAGGGC
CCCGCCGACCTCGCGCTCGCGGCCGTACGCGGCCTCGTCCACTCGGCGCAGACCGAGAAC
CCGGACCGCATCCAGCTCCTCGACACCGACGGCACCGAGGCCTCCACCGCCGTACTCCAC
CGGGCCCTGCTCAGCGAGGAGCCCGAACTCGCCCTGCGCGAAGGGGAGTTCCGCGCCCCC
CGGCTGGTGCGCACCGCACCGGGAGGCGAGGGCTCCGAGTGGGACCCCGAGGGCACCGTC
CTGATCACCGGCGGCACCGGAGCGCTCGGCGCCCTCCTCGCCCGCCACCTGGTCACCCGG
CACGGCGTACGGCACCTGCTGCTCACCGGGCGCCGCGGCCTCGACACCCCCGGCGCCGCC
GAACTCGTCGCGGAACTCGCCGAGTCGGGCGCCCGGACCGCCGTGGCCGCCTGCGACGCC
GCCGACCGGGAACAGCTCGCCTCGCTCCTCGCGACCGTGCCCGCCGACCGCCCGCTGCGC
GCCGTCGTGCACGCCGCCGGGGTCCTCGACGACGCCACCACGGCCACCCTCAGCGAGGAG
CAGCTGACCCGGGTGCTGCGGCCCAAGGCCGACGCCGCCTGGCATCTGCACGAGCTGACC
CGCGAACTCGACCTGACCGCCTTCGTGCTGTTCTCCTCCGCCGCGGGCGCCTTCGGCAAC
CCCGGCCAGGGCAACTACGCCGCCGCCAACTCCTTCCTCGACGCGCTCGCCGACCACCGC
CGCGCCGAGGGCCTGCCCGCTGTCTCCCTCGCCTACGGGCTGTGGCAGAGCGAGGGCATG
CCCGGACACCTCGACAGCGCCGAACTCGGCTGGTCGGCACGGGCCGGATACCTCCCGCTC
CGCCCCGAGCAGGGCCTCGCCGCCTTGGACGCGGCCGACTCCCACCGCGGCGAGCCGCTG
CTCGTCACGGTCCCGCTCGACAAGGCCGTACTGCGCGCCCGCGCCGCCTCCGGGGTGCTG
CCGCACCTCTTCCGCTCCCTGGTACGGGTGCCGTCCCGCCGCGCCGTGGAGAACGGCGCC
CAGGGCACCGGATCCGCCCTCGCCGACCGCCTCGCCACGCTCGACCCCGAGGCCCGGCAA
GCCGAACTCCTCGACCTCGTACGGGGATTGGTCGCCGCCGTGCTCGGCCACGACGAGCCG
GAGGCGATCGAGCCGGACAAGGCCTTCAAGGAACTGGGCTTCGACTCGCTGACCGCCGTC
GAGCTGCGCAACCGCCTCGCCGCCGCGACCGGCCTGAAGCTCCCGGCCACCCTGGTCTTC
GACCACCCGAGCCCCGGCGCCCTCGCCCGCCACCTGCTCACCGCGCTCCTCGCCACCGGC
GGCCCCGCCGCCACCGCCCCGGCCGCCACCGCCACCGGCAGCGACGAGCCGATCGCCATC
GTCGCGATGGCCTGCCGCTACCCCGGCGGGGTCAGCACCCCCGAGGAGCTGTGGCAGCTG
GTCGCCGAGGGCCGGGACGCCGTCTCCGGCTTCCCCGAGGACCGCGGCTGGGACCTGGAG
GGCCTCTACGACCCGGAGGGCAACCGCCCCGGCAGCTCGTACACCCGCAGCGGCGGATTC
CTCTACGACGCCGCCGACTTCGACCCCGAGCTGTTCGGGATCTCGCCGCGCGAGGCCGTC
ACCATGGACCCGCAGCAGCGCCTCCTCCTGGAGACCACCTGGGAGGCCTTCGAGCGCGCC
GGTCTCGACCCGCTCGGCCTCCAGGGCAGCAGGACCGGTGTCTTCGCGGGCGTGATGTAC
CACGACTACGCCTCGCACGTGGAGCAGGCCGCCGACAGCGCCGAGGGCTATCTGCTCACC
GGCACCTCCGGCAGCGTCATCTCCGGCCGCCTCTCCTACGCCTTCGGCCTGGAGGGCCCC
TCGGTCAGCGTCGACACCGCCTGCTCCTCCTCGCTGGTCGCCATGCACCTGGCCGCGCAG
GCGCTGCGCGCGGGGGAGTGCAGCCTCGCCCTCGCCGGGGGCGTCACCGTGATGGCCACG
CCCAATGTCTTCGTGGAGTTCAGCCGCCAGCGCGGACTCTCCTCCGACGGGCGCTGCAAG
TCCTTCTCCGCCACCGCGGACGGCACCGGCTGGGCCGAGGGCGCGGGCGTCCTCCTCCTG
GAGCGCCTCTCCGACGCCGAGCGCAACGGCCACCGGGTGCTCGCGGTGATGCGCGGCTCC
GCCGTCAACCAGGACGGCGCCTCCAACGGCCTCACCGCCCCCAACGGCCCCTCCCAGCAG
CGCGTCATCGAGCAGGCGCTCGCCGGCGCCCGGCTCACCCCCGCCGAGGTGGACGCGGTC
GAGGCGCACGGCACCGGCACCACCCTGGGCGACCCCATCGAGGCGCAGGCCCTGCTCGCC
ACCTACGGGCAGCAGCGCGAGAGCGACCGGCCGCTGTGGCTCGGCTCCATCAAGTCGAAC
ATGGGCCACGCCCAGGCCGCCGCCGGTGTGGCGGGCGTCATCAAGATGGTGCAGGCCATG
CGGCACGGCATCCTGCCGAAGACGCTGCACGCCGAGGAGCCCTCCCCGCACATCGACTGG
TCCGAGGGCGCGGTCGCCCTCCTCACCGAGGCCACCCCCTGGCCCGAGACCGGCCGCCCG
CGCCGCGCCGGTGTCTCCTCCTTCGGCGCCAGCGGCACCAACGCCCATGTCGTCCTGGAG
GCCGCCCCGGAGCCCGCCGAGACGGCGGAAGCGGCCGAGGACTCCGCCGCGGGCCCCTAC
CTCTGGCCGCTCTCCGGCCGGGGCGAGTCCGCCCTGCGGGCCCAGGCGGCACGACTGCAC
GCCCACGTCAGCGCCCGGCCCGCACTCCGCCCGGCCGATGTGACGCTCTCCCTCACGACC
GGCCGCCCCGCCCTCGAACACCGGGCCGCCGTCACCGCCGCGGACCGCGAGGGCCTGCTC
ACCGCCCTCGCCGCCCTCGCCGAGGGCACCCGCGCCCCCGGACTCACCCAGTCCTCCCCC
CGCGGCGGCAAGCTGGCCTTCCTGTTCTCGGGTCAGGGTGCGCAACGCCTGGGTATGGGG
CGGGAGTTGTATGCGGTGCAGCCGGTGTTCGCGGCTGCTTTCGATGAGGTGTGCGCGGGT
TTCGGTGCGGACTTCCGGGAGCGTGTGTTCGCTGCTGAGGGTGGGGAGTTGGACCGTACG
GGTCTGACGCAGCCCGCGCTCTTCGCCATTGAGGTGGCGCTGTTCCGTCTGGTGGAGTCC
TTCGGTGTACGTGCGGACTTCCTGGCGGGGCACTCCATCGGGGAGTTGGCGGCGGCTCAT
GTGGCGGGTGTGCTGTCTCTTGAGGATGCCTGCACGCTGGTGGCTGCTCGTGGTCGGTTG
ATGGAGGCGCTTCCCGCGGGTGGCGCGATGGTCTCCATACGGGCGGCTGAGGTGGAAGTC
CGGTCGCGTATCGGGGAGTTCGAGGGCCGTGTCGACATCGCCGCGGTCAACGGCCCCGAG
TCGGTCGTGGTCTCCGGCGAAGAGGCAGCCGTCCTCGAACTCGCGGAGGCGTTGGCGGAG
TCGGGTCACAAGACGAAGCGGCTGCGTGTGTCGCACGCCTTCCACTCGCCGTTGATGGAG
CCGATGTTGGAGGAGTTCCGGCGTGTCGCGTCGGGGCTGGCGTACGGTTCGCCGTCGATT
CCGGTGGTGTCGAATCTGACCGGTGAGCTGGTGACCGCGTTCGATGCCGCGTACTGGGTG
GAGCATGTGCGCCACGCCGTGCGCTTCGCCGACGCGATCGGTTTCCTCGCCGCTGAGGGC
GTGACCCGCTTCGTGGAGCTGGGTCCGGACGGCGTGCTGAGCGCGATGGCGCGGGACTGC
CTGCCGGAGACCTTCGACGGGCTCCTGGTGCCGGTGCTGCGCAAGGACCGCCCGGAGGCC
GAGACCTTCCTCGCCGCGCTCGGCGAGGCCTGGACCAAGGGCATCCGGCCCGACTGGGCG
GCACTGACCGCCGGGCAGGCGGCACGCCCGGTCGAGCTGCCCACGTACGCCTTCCAGCGG
CTGCGCTACTGGCCGAAGCCCGCCCGTCCGGCGGGGGATGTGGCCGCCGCCGGTCTCGGC
GCGGCCGGGCACCCCCTGCTCGGCGCCACCGTGGCCGCGGCCGACGGCGGGCAGATCCTG
CTCACCGGGCGCCTGTCGCTGAGCAGCCACCCCTGGCTCGCCGACCACGCGGTCGCCGGG
ACCGTGCTGCTGCCGGGTACGGCCTTCGTCGAACTCGCCCTGCGCGCGGGCGAGGAGGCG
GGCGTCCCGCACCTCGCCGAGCTGGTCCTCGAAGCACCCCTGGTCCTGCCCGCCCGGCAG
GCGGTGCAGATCCAGGTGCTCGTCGGCCCCGCCGAGGAGGACGGCGGCCGTGCCGTCTCC
GTGCACTCCCGGGCCGGAGCGCCGGGGGAGAGCGACGCCCTCTGGGTGCGCAACGCCGCC
GGACGCCTCACCCACCCCGCCCCCGAAGCCCCCGCCGAGCCCGGCAACTGGCCGCCCGCG
GGCGCCGAACCGGTCGACCTGGACGGCTTCTATGCGGGGCTCGCCGCGGCCGGTTACGGG
TACGGCCCGGCCTTTCAGGGGTTGGCCAAGGCCTGGCGCTCGGGCGACGGTGACCAGGTG
TTCGCCGAGGTGGAGCTGCCCGAGTCGCAGCAGGACGAGGCGGGCCGGTTCGCTCTGCAC
CCGGCCCTGCTCGACGCTGCCCTGCACGGGCTCGCAGCCGCCGGGCCGGCGACGGCGGAA
GGACAGGTGCGGCTGCCCTTCTCCTGGAACGGTGTGCGCCTGCACGCCGTCGGCGCCTCC
CGGCTGAGGGTCCGGATGGCGACGGCCGGCCCGGACTCCCTCTCCCTCGACATCGCGGAC
CCCGAGGGCCACCCGGTCCTCGGCGTGGAGTCCCTCGCCACCCGTGCCGTCCCCGTCGAG
CAGCTCGCCGCCGCGGCCACCGCGAGCACCACCGAGCACCTGTACCGCCTCGACTGGTCC
GCGGTTCCCGCCGCCTCCGCCGCCGAGCCCCCGCACCTGCTGCGGATCGGCGCCGGGGAT
GCCCCGGGGGCCCCGTACCGGGCGAGCCACCCGGATGTGGCGGCCCTGACCGCCGCCCTC
GACGCGGATGCCACCCCGCCCGGCGCCGTCGTGCTCGACGTCCCCGGCGCCACGGCCTCC
GGCGCGGAGGCGGCCCGGGAGACCGCCGCCGCCGTGCTCGGCGTCCTCCAGGAGTGGCTG
GCCGCCGAACAGCTCGCGGACGTACGCCTGTTCGTGCGCACCCGGCGGGCCGTGGCGGTC
CGCTCCGGCGAGGACGTGACCGCGCTCGCCCAGTCCCCGGTCTGGGGCCTGGTGCGCGCC
GCGCAGGCGGAGAACCCGGGCCGACTGGTCCTCGTCGACACCGACGCCGACTGGGACACG
CCGCTGCCCGAGGCGGTCTTCGCCGCCGCCGAGGAGCCGCAGCTCGCGGTCCGCGAGGGA
GCGCTGCTCGCCCCGCGCCTGGTGCGCGGCTCCGCGCCCGGTGCCGCTCCCGCCCTCCCG
GCCGGTGGCGCCTGGACCCTCGACACCACCGGCGGCGAGACCCTGGAAGACCTCGCCTTC
CTGCCCTGTGAGGCGGACCGGATCCCGCTCGCCGAGGGCGAGATCAGGGTCGCCGTGCGG
GCCGCCGGGCTGAACTTCCGCGATGTCCTCATCGCGCTCGGCATGTACCCGGGGGCCGCC
CGGATGGGCAACGAGGGCGCCGGAATCGTCACCGAGATCGGCCCCGGCGTCACCGGCCTC
GCGGTCGGGGACCGGGTCACCGGCCTGATCCGCGGCGCCTTCGGCCCCCTCGCCGTGGTG
GACCGGCGCCTGGTCGTCCGCGTCCCGGAGGGCCTCAGCTTCGAGCAGGCGGCGGCCCTG
CCCACCGTGTTCCTCACCGCGTACTACGGGCTCGTCGACCTGGCCGGGCTCCGGCGCGGC
GAGAAGGTCCTCGTGCACGCGGCGGCGGGCGGCGTCGGCATGGCCGCCGTGCAGCTCGCC
GAGCACCTGGGCGCGGAGGTCTTCGGCACCGCCAGCGAGGGCAAGTGGGACACCCTGCGC
GCCCTCGGCCTGGACGAGCGGCACCTCGCCTCCTCGCGCACCGCGGCCTTCGAGGAGACC
TTCTCCGCGGCGACCGGCGGCGAGGGCGTGGACGTGGTCCTGGACTGCCTGGCCGGTGAA
CTGGTGGACGCCTCCCTGCGGTTGCTGCCGCGCGGCGGACGCTTCCTGGAGATGGGCAAG
ACCGACGTACGCGACCCGGCCGAGATCGCCGCGAGCTACCCCGGCGTCGACTACCGCGCC
TTCGACATGGTCGAGGGCGCCGGTCCGGACCGTATCGGGGAGATGCTGGCGGAGCTCGCC
GAACTGTTCGAGGCGGGGGTGCTGAAGCCGCTGCCGGTGCGGTCGTGGGACATCCGGCGT
GCGGGTGAGGCGTTCCGGTTCATGTCGCAGGCGCGGCATGTGGGCAAGATCGTGCTGACG
GTTCCGCAGGTCTGGGATCCGTCGGGGACGGTCTTGGTGACCGGTGGTACGGGTACGTTG
GGTGCGCTGGTGGCCCGGCATCTGGTGGTGGAGCACGGGGTGCGGCATCTGGTGCTGGCG
GCGCGTCGTGGTCCTGAGGCGCCGGGTGCGGCCGAACTCGTGGCGGAACTGGGCGAGTTG
GGTGCGCAGGCGGAAGTGGTGGCCTGCGACGCTGCCGATCGCGGGCAGCTGGCGAAGCTG
CTCGACGGGATCGACGGGGCGCGTCCGCTGCGTGCGGTGGTGCACACCGCCGGAGTCCTC
GACGACGCGGTGCTCGCCGCCCAGACCCCGCAGAAGCTGGACCGGGCGATGCGGCCCAAG
GTGGACGCCGCGCTCAACCTCCACGAGCTGACCCGCGACCTGGACCTGACCGCCTTCGTC
CTCTACTCCTCCGTCGCCGGGGTCCTCGGCGGCCCGGGACAGTCCAACTACGCGGCGGCC
AACGCCTTCCTGGACGCCCTCGCCGCGCACCGCCGCGCCCAGGGGCTGCCGGGCGTCTCG
CTCGCCTGGGGCCAGTGGGCCGAGGCGAGCGGTATGACCGAGGGGCTCGCGGGCGCCGAC
CTGGCGCGCATGAACCGCAGCGGGGTGCTGCCGCTGCCCAGCGAGCAGGGCCTCGCCCTG
TTCGACGAGTCCGCCCGGCACGACGAGCCGCTGCTCGCCGCCGTACGCCTCGATGCGGCC
GCGCTCCGCAACCAGGCGGAGGCGGGCAGGCTGCCCGCCCCGCTGCGCGGCCTGGTGCGC
ACCGCCGTGCGCCGGGCCGCCGCCGGTACCGCTGCCACCGCGGCCGGTGCCGCCGCGCTC
GGGCAGCGGCTCGCCACGCTCGCCGAACCGGAGCGCGCGGACGCCTTGCTCGACCTGGTA
CGCGGCCATGTCGCCACCGTCATCGCCCACCCCGACCCGGCGGCGATCGACACCGAACGG
GGCTTCCTCGACCTCGGGTTCGACTCGCTGACCGCCGTTGAACTGCGCAACGGCCTCGGC
GCCGCCACCGGCCTGCGCCTGCCCACCACGCTGATCTTCGACTACCCCTCGCCCGCCGCG
CTCGCCGGGCACCTGCTCGCCGAACTGCGGCCCGAGGGCGGCGAGGACGGGGCGGCGGAC
ACCGCGGTCCTCGGCGCGATGTCCGAGTGGGAGGCGGCGATCGCCGCCCTGCCCGCGGGC
AGCGAGGGGCGCGAGAAGGCCGTCAAGCGGCTGCGCTCGCTGCTGTGGAAGTTCGACCGG
ACCGAGAACGAGACCGACGAGGAAGCGCAGGGCCAGGAGGGCGGCAGCACGCTCACCGCG
GCCACCGACGACGAGATGTTCGCCCTGATCGAGAACGAACTCGGCCTCAACTGA
[3] KS34..409
[3] AT570..887
[3] methylmalonyl-CoA761..765
[3] DH937..1102
[3] KR1398..1578
[3] ACP1683..1753
[4] KS1775..2151
[4] AT2307..2617
[4] malonyl-CoA2492..2496
[4] DH2664..2828
[4] ER3153..3459
[4] KR3469..3649
[4] ACP3756..3826
[3] KS100..1227
[3] AT1708..2661
[3] methylmalonyl-CoA2281..2295
[3] DH2809..3306
[3] KR4192..4734
[3] ACP5047..5259
[4] KS5323..6453
[4] AT6919..7851
[4] malonyl-CoA7474..7488
[4] DH7990..8484
[4] ER9457..10377
[4] KR10405..10947
[4] ACP11266..11478

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [760-877]  3.8e-69 G3DSA:3.40.366.10 [2492-2606]  5.1e-77 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR006162 Phosphopantetheine attachment site (PTM)
 [1711-1726]  PS00012 [3784-3799]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1676-1792]  4.5e-33 SSF47336 [3747-3833]  1.1e-22 SSF47336
SSF47336   ACP-like
 [1683-1753]  21.53 PS50075 [3756-3826]  19.226 PS50075
PS50075   ACP_DOMAIN
 [1686-1752]  7.9e-16 PF00550 [3759-3825]  5.7e-11 PF00550
PF00550   PP-binding
 [1680-1755]  1.2e-23 G3DSA:1.10.1200.10 [3754-3830]  2.7e-20 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
IPR011032 GroES-like (Domain)
 [3144-3298]  2.7e-34 SSF50129
SSF50129   GroES-like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [3173-3227]  1.8e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1398-1577]  2.7e-63 PF08659 [3469-3648]  5.9e-64 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-283]  1.1e-96 PF00109 [1775-2026]  3.2e-98 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [291-409]  3.8e-47 PF02801 [2034-2151]  4.7e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [570-887]  1.8e-106 PF00698 [2307-2617]  8.6e-63 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  2.3e-11 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [568-870]  9.3e-65 SSF52151 [2304-2584]  1e-72 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [695-760]  2.3e-18 SSF55048 [2426-2491]  8.9e-17 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [36-295]  1.5e-87 G3DSA:3.40.47.10 [296-461]  3.9e-62 G3DSA:3.40.47.10 [1775-2037]  5.3e-91 G3DSA:3.40.47.10 [2038-2206]  4e-64 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [26-407]  1.7e-103 SSF53901 [1768-2204]  3.6e-102 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1398-1609]  7.5e-36 G3DSA:3.40.50.720 [3288-3383]  5.1e-21 G3DSA:3.40.50.720 [3470-3649]  1.7e-33 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [196-212]  PS00606 [1939-1955]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [572-869]  2.1e-116 SM00827 [2308-2597]  7.8e-117 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1684-1756]  4.2e-35 SM00823 [3757-3829]  6.2e-32 SM00823
SM00823   Phosphopantetheine attachment site
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [937-1102]  4.3e-86 SM00826 [2664-2828]  3e-80 SM00826
SM00826   no description
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-461]  1e-216 SM00825 [1778-2204]  1.2e-232 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1398-1578]  9.8e-59 SM00822 [3469-3649]  2.4e-62 SM00822
SM00822   no description
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [3153-3459]  3.2e-186 SM00829
SM00829   Enoylreductase
SignalP No significant hit
TMHMM No significant hit