close all open/close all

CDS information : Salino_00930


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction129,580 / 137,658 / + [in whole cluster]
129,580 / 137,658 / + [in contig]
Location129580..137658 [in whole cluster]
129580..137658 [in contig]
TypeCDS
Length8,079 bp (2,692 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I modular polyketide synthase
Gene
Gene (GenBank)salAIII
EC number
Keyword
Note
Note (GenBank)
  • Polyketide synthase domains: KS, AT, ACP, KS, AT,KR, ACP
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Related Reference
ACC
H6D571
NITE
Salino3_00150
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)

close this sectionPKS/NRPS Module

5 malonyl-CoA
6 malonyl-CoA
KS37..413
AT573..881
ACP1006..1076
KS1096..1472
AT1627..1936
KR2252..2433
ACP2539..2609

close this sectionSequence

selected fasta
>polyketide synthase [type I modular polyketide synthase]
MASASNEEKLRDYLKLVTADLQQTRRRLQAVEAKGQEPVAIVGMACRYPGGVDSPEDLWQ
LVSSGEDGITAFPTDRGWDLDGLYDPDPDHPGTSYVREGGFVHQAGGFDAEFFGIPPREA
LAMDPQQRLFLESSWEAFERAGIDPTTVKGSRTGVFVGAGNPGYLGGGTGTPPQEVEGYT
LTGNVNSVISGRVAYTFGLEGPAVTVDTACSSSLVAIHWAAQALRGEECTMALAGGVTVM
PNPWLFQEFSRQRGLARDGRVKAFSAAADGTVWGEGVGVLVLERLSDARRNGHRVLGLVS
GSAINQDGASSGLTAPNGPSQQRVIEAALAGARLTPLDVDAVEAHGTGTALGDPIEAQAL
LATYGQGRSAENPLLLGSVKTNIGHTAAAAGVAGVIKMVMAMRHGTLPQTLHAEEPTPEV
DWSPGTVRLLTENTPWPAADRPRRAGVSSFGISGTNAHVIVEGAPAEEEPTPAAAPETPA
APARGPLPWALSGRSAAAVRAQAAKLLDHLAAAPADPADLGTSLLTTRAALDHRALILAE
DLAQGTEALRALAEGTPHPSVTEGTARPGKLAFLFSGQGAQRLGMGRELYAVQPVFAAAF
DEVCAGFGADFRERVFAAEGGELDRTGLTQPALFAVEVALFRLVESFGLTPDFLAGHSIG
ELAAAHVAGVLSLEDACTLVAARGRLMEALPEGGAMVSVRASEAEVRSRIGEFEGRVDIA
AVNGPESVVLSGEEAAVLELADVLAESGHKTKRLRVSHAFHSPLMEPMLEEFRRVASELT
YDTPSIPVVSNLTGELVRAFDAAYWVEHVRHAVRFADGIALLSARGVTRFLELGPDGVLS
AMAQECLPEDFTGLLVPLLRKDRPEAETFLAALAEAWTRGAGPDWSPLFAGRPGRTVDLP
TYAFQRRHYWLTPALGARDEAEEEFWRALDEEDIDSLVDALGIDAGRSLREALPEMASWL
RRRRDPETRKALAALRAEPSAEDSETAAALRATLRELPEPEQLRTVLDLVRTQAAVVLGH
SGKEAVDAGRAFKELGFDSLAAVNLRNRINNATGLRLPAAFAFDYPTPEAVAAHVRAEIL
GESTAASAVLPSAASDEPIAIVAMACRYPGGVRSPEDLWQLVDSGADVISGFPTDRGWDL
DGLYHPDPDHPGTSYVREGGFLHDAAEFDPAFFGISPREALAMDPQQRLVLETAWEVFER
AGIDPARVKGTPTGVFAGATQPGYFGGMTTMGEGAEGYSLTGNLTSVISGRIAYTFGLEG
PAVTVDTACSSSLVAMHLAAQALRAGECRLALAAGVTVMPTPDLFVEFSRQRGLAKDGRA
KAFSAEADGTAWSEGAGVLLLERLSDAERNGHQVLAVLRGSATNQDGASNGLMAPNGPSQ
QRVIRQALANARLSPSEVDAVEAHGTGTALGDPIEAQALLATYGQERDGDRPLLLGSLKS
NIGHTSAAAGVAGVMKMVMAMRHGRLPRTLHAEQATPHVDWSSGSVALLTSAAPWPETGR
PRRAGVSSFGVSGTNAHVIVEQAPEPAPVTAEAPREGEPLPWLLSARTPDALREQARRLR
DFLTGTPGLPAAEVATALYTGRAQLDFRAAVLTDSEPDLLAALDALAEGSTDPATAQGTA
TPGPLAFLFSGQGAQRLGMGRELYAAQPVFAAAFDEVCAGFGADFRERVFAAEGGELDRT
GLTQPALFAIEVALFRLVESFGVRADFLAGHSIGELAAAHVAGVLSLEDACTLVAARGRL
MEALPAGGAMVSVRAAEVEVRSRIGEFEGRVDIAAVNGPESVVLSGEEAAVLELAEALAE
SGHKTKRLRVSHAFHSPLMEPMLEEFRRVASGLAYGSPSIPVVSNLTGELVTAFDAAYWV
EHVRHAVRFADAIGFLAERGVRHFLELGPDGVLSAMAQECLPETFEGLLVPVLRKDRPEA
AAFLAALGAAWTRGIALDWSPLLDGTARAAAELPTYPFQRQRYWLEAPVAAAGEQSEVDG
QFWDAVEREDLESLADTLRLPSGDSGLRTVLPALSSWRRGSREQAVIDSWRYRITWKTLP
AGDTPRLDGTWWIVVPSGASGAGTLAQEAAAALTAHGAVTVPVELDATGADRARWAAELA
ARQGESPTGVLSLLALDARPHSAHPGVSAALAGTAALAQALGDAELTAPLWNLTSGGVST
GPGDPAADSTGTQAQVWALGRVAALEYPDRWGGSVDLPPAPDERALARLVSVLAAGDGED
QLAVRASGVRARRLRTAPVPADRRPEPWTPTGTVLITGGTGALGSRLAEWLADRGAPRLV
LTSRRGAEAPGARELAARIEEKGTAVTLAACDVSDREQLTGLLKEITAEQPLTAVVHAAG
VSDNGFMDEVTGEHLAHVLRPKALAADLLHEVTLELGLELEAFVLFASSAGMWGSGGQAA
YAAANAHLDALAERRRALGLAATAVAWGPWAEAGMAASEDIDEHLRRRGVIGIAPATAIA
ALQQALDLDESTVGVADVDWSLFAPTFTAMRHSPLIAELPAVKAALEEDEPSAAADSAAA
SALLDKLGRASAADQQHLLVELVRAQAAAVLGHRTAEAVQEARPFKDLGFDSLTAVELRN
RIATETGLRLPATLLFDHPTPGALAQHLRSHLVVDEAGTDAAVLADLDRLDAALTRLAPD
EAARHRIAGRLQVLVSKWGATAQTEEEGAHDDLASASAEEIFALIHDELGKS
selected fasta
>polyketide synthase [type I modular polyketide synthase]
ATGGCCAGCGCCAGCAACGAAGAGAAGCTCCGCGACTACCTGAAGCTCGTGACCGCCGAC
CTGCAGCAGACCCGCAGGAGGCTGCAGGCCGTCGAGGCCAAGGGCCAGGAGCCGGTGGCG
ATCGTCGGCATGGCCTGCCGCTATCCGGGCGGCGTCGACTCGCCGGAGGACCTGTGGCAG
CTGGTCTCCTCCGGCGAGGACGGCATCACCGCCTTCCCTACCGACCGCGGCTGGGACCTG
GACGGGCTCTACGACCCGGACCCGGACCACCCCGGCACCAGCTATGTGCGCGAGGGCGGC
TTCGTCCACCAGGCGGGCGGCTTCGACGCGGAGTTCTTCGGGATCCCGCCGCGTGAGGCG
CTGGCCATGGACCCGCAGCAGCGGCTCTTCCTGGAGTCCTCCTGGGAGGCCTTCGAGCGG
GCGGGCATCGACCCGACCACGGTCAAGGGCAGCCGCACCGGCGTCTTCGTCGGCGCGGGC
AACCCCGGCTACCTCGGCGGCGGCACCGGAACCCCGCCGCAGGAGGTCGAGGGCTACACC
CTCACCGGCAACGTCAACAGCGTGATCTCCGGCCGGGTCGCCTACACCTTCGGCCTCGAA
GGGCCCGCGGTCACCGTCGACACCGCCTGCTCCTCCTCCCTGGTGGCGATCCACTGGGCC
GCCCAGGCGCTGCGCGGCGAGGAGTGCACCATGGCGCTCGCCGGGGGCGTCACCGTCATG
CCCAACCCCTGGCTCTTCCAGGAGTTCAGCCGCCAGCGGGGCCTGGCCAGGGACGGCCGG
GTCAAGGCCTTCTCCGCCGCCGCGGACGGCACCGTCTGGGGCGAGGGCGTCGGCGTCCTC
GTCCTGGAGCGCCTGTCCGACGCCCGCCGCAACGGGCACCGCGTGCTCGGCCTGGTCAGC
GGCTCCGCCATCAACCAGGACGGCGCGAGCAGCGGGCTGACCGCCCCCAACGGCCCCTCC
CAGCAGCGGGTCATCGAGGCCGCGCTCGCCGGCGCCCGCCTCACCCCCCTCGACGTGGAC
GCGGTCGAGGCGCACGGCACCGGCACCGCCCTCGGCGACCCCATCGAGGCACAGGCCCTG
CTCGCCACCTATGGCCAGGGGCGCAGCGCCGAGAACCCGCTGCTGCTCGGCTCGGTGAAG
ACCAACATCGGCCACACCGCCGCCGCCGCGGGAGTCGCGGGCGTCATCAAGATGGTGATG
GCCATGCGGCACGGCACCCTCCCGCAAACCCTGCACGCCGAGGAGCCCACCCCCGAGGTC
GACTGGTCCCCGGGCACCGTCCGCCTGCTCACCGAGAACACCCCCTGGCCCGCCGCCGAC
CGCCCCCGCCGGGCAGGCGTCTCCTCCTTCGGCATCAGCGGCACCAACGCCCACGTCATC
GTCGAAGGAGCCCCCGCGGAGGAGGAGCCGACCCCCGCCGCGGCCCCCGAGACCCCCGCG
GCCCCTGCGCGCGGCCCGCTGCCCTGGGCGCTCTCCGGCCGCTCCGCCGCCGCCGTACGG
GCCCAGGCCGCCAAACTGCTCGACCACCTCGCCGCCGCCCCCGCCGACCCGGCCGACCTC
GGCACCTCGCTGCTCACCACCCGGGCCGCCCTCGACCACCGCGCCCTGATCCTCGCCGAG
GACCTCGCCCAGGGCACCGAAGCCCTGCGCGCCCTCGCCGAGGGCACCCCGCACCCCTCC
GTCACCGAGGGCACCGCCCGCCCCGGCAAGCTGGCCTTCCTGTTCTCGGGTCAGGGTGCG
CAACGCCTGGGGATGGGGCGGGAGTTGTATGCGGTGCAGCCGGTGTTCGCGGCTGCTTTC
GATGAGGTGTGCGCGGGTTTCGGTGCGGATTTCCGGGAGCGCGTGTTCGCTGCTGAGGGT
GGGGAGTTGGACCGTACGGGTCTGACGCAGCCCGCGCTCTTCGCCGTCGAGGTGGCGCTG
TTCCGCCTGGTCGAGTCCTTCGGCCTCACCCCGGACTTCCTCGCGGGCCACTCCATCGGG
GAGTTGGCGGCGGCTCATGTCGCGGGCGTGCTGTCCCTGGAGGATGCCTGCACGCTCGTC
GCCGCTCGTGGCCGGTTGATGGAGGCGCTTCCCGAGGGTGGCGCGATGGTCTCCGTACGG
GCGAGCGAGGCGGAAGTCCGGTCGCGTATCGGGGAGTTCGAGGGCCGCGTCGACATCGCC
GCGGTCAACGGCCCCGAGTCGGTCGTCCTCTCCGGTGAGGAAGCTGCCGTTCTCGAACTC
GCGGACGTACTGGCGGAGTCGGGTCACAAGACCAAGCGGCTGCGCGTCTCGCACGCCTTC
CATTCGCCGCTGATGGAGCCGATGCTGGAGGAGTTCCGGCGTGTCGCCTCGGAGCTGACG
TACGACACGCCGTCGATCCCGGTGGTCTCCAATCTGACCGGCGAGCTGGTCCGCGCGTTC
GATGCCGCGTACTGGGTGGAGCATGTGCGCCACGCCGTGCGCTTCGCCGACGGCATCGCG
CTGCTCAGCGCCCGCGGGGTCACCCGCTTCCTCGAACTCGGCCCGGACGGCGTCCTGTCC
GCCATGGCGCAGGAGTGCCTGCCCGAGGACTTCACCGGGCTCCTGGTCCCGCTGCTGCGC
AAGGACCGCCCGGAGGCCGAGACCTTCCTCGCCGCGCTCGCGGAGGCCTGGACCCGGGGC
GCCGGACCCGACTGGTCCCCGCTCTTCGCCGGGCGCCCCGGCCGCACCGTCGACCTGCCC
ACCTACGCCTTCCAGCGGCGCCACTACTGGCTCACCCCCGCACTCGGCGCCCGCGACGAG
GCCGAGGAGGAGTTCTGGCGCGCCCTCGACGAGGAGGACATCGACTCCCTGGTCGACGCG
CTCGGCATCGACGCCGGGCGGAGCCTGCGCGAGGCCCTGCCCGAGATGGCCTCCTGGCTG
CGCCGCCGCCGGGACCCGGAGACCCGCAAGGCACTGGCGGCCCTGCGCGCCGAGCCGAGC
GCCGAGGACAGCGAGACGGCCGCCGCGCTCCGCGCCACCCTGCGCGAACTGCCCGAGCCG
GAACAGCTGCGGACCGTCCTCGACCTGGTCCGCACCCAGGCCGCCGTCGTCCTCGGGCAC
AGCGGCAAGGAGGCCGTCGACGCCGGACGCGCCTTCAAGGAGCTCGGCTTCGACTCGCTG
GCCGCCGTCAATCTGCGCAACCGCATCAACAACGCCACCGGCCTCCGGCTGCCCGCCGCC
TTCGCCTTCGACTACCCCACCCCGGAGGCGGTCGCCGCCCACGTACGCGCCGAGATCCTC
GGGGAGAGCACCGCCGCGAGCGCCGTACTGCCGAGCGCGGCCTCGGACGAGCCGATCGCG
ATCGTCGCCATGGCCTGCCGCTACCCCGGCGGGGTGCGTTCCCCCGAGGACCTGTGGCAG
CTCGTCGACTCCGGCGCCGACGTCATCTCCGGCTTCCCCACCGACCGCGGCTGGGACCTG
GACGGGCTCTACCACCCGGACCCGGACCACCCCGGCACCAGCTATGTGCGTGAGGGCGGC
TTCCTGCACGACGCCGCCGAGTTCGACCCGGCCTTCTTCGGGATCTCCCCGCGTGAGGCG
CTGGCCATGGACCCGCAGCAGCGGCTCGTCCTGGAGACGGCCTGGGAGGTCTTCGAGCGC
GCCGGTATCGACCCGGCCCGGGTGAAGGGCACCCCGACCGGCGTCTTCGCGGGCGCCACC
CAGCCCGGCTACTTCGGCGGCATGACGACGATGGGCGAGGGCGCCGAGGGCTACTCGCTC
ACCGGCAACCTCACCAGCGTCATCTCCGGCCGCATCGCCTACACCTTCGGCCTGGAAGGG
CCCGCGGTCACCGTCGACACCGCCTGCTCCTCCTCGCTGGTCGCCATGCACCTGGCCGCG
CAGGCGCTGCGCGCGGGGGAGTGCCGTCTCGCGCTCGCCGCCGGGGTCACCGTCATGCCG
ACCCCGGACCTCTTCGTGGAGTTCAGCCGCCAGCGCGGCCTCGCCAAGGACGGCCGGGCC
AAGGCCTTCTCCGCCGAGGCCGACGGCACCGCCTGGTCCGAGGGCGCCGGCGTACTCCTC
CTGGAACGCCTCTCCGACGCCGAGCGCAACGGGCACCAGGTCCTCGCCGTGCTGCGCGGC
TCCGCCACCAACCAGGACGGCGCCAGCAACGGCCTGATGGCGCCCAACGGCCCCTCCCAG
CAGCGGGTGATCCGCCAGGCCCTCGCCAACGCCCGGCTCAGCCCGAGCGAGGTCGACGCG
GTCGAGGCGCACGGCACCGGCACCGCCCTCGGCGACCCCATCGAGGCGCAGGCCCTGCTC
GCCACCTACGGCCAGGAACGGGACGGGGACCGGCCGCTGCTGCTCGGCTCCCTGAAGTCC
AATATCGGCCACACCTCCGCCGCGGCCGGTGTCGCGGGCGTGATGAAGATGGTGATGGCC
ATGCGGCACGGCAGGCTGCCGCGCACCCTGCACGCCGAGCAGGCCACCCCGCACGTCGAC
TGGAGCAGCGGCTCGGTCGCCCTGCTCACCAGCGCCGCCCCCTGGCCCGAGACCGGCCGC
CCGCGCCGCGCCGGCGTCTCCTCCTTCGGTGTCAGCGGCACCAACGCCCATGTCATCGTC
GAGCAGGCACCCGAGCCCGCGCCGGTCACCGCCGAGGCACCCCGCGAGGGCGAGCCGCTG
CCGTGGCTGCTCTCCGCCCGCACCCCCGACGCCCTGCGCGAACAGGCCCGCCGCCTGCGG
GACTTCCTCACCGGCACCCCCGGGCTGCCCGCCGCCGAGGTCGCCACCGCCCTGTACACG
GGCCGCGCCCAACTCGACTTCCGGGCCGCCGTCCTGACCGACTCGGAGCCGGACCTCCTC
GCCGCCCTCGACGCCCTCGCCGAGGGATCCACCGACCCGGCCACCGCCCAGGGCACGGCC
ACCCCCGGACCGCTCGCCTTCCTTTTCTCGGGTCAGGGTGCGCAACGCCTGGGGATGGGG
CGTGAGTTGTATGCGGCGCAGCCGGTGTTCGCGGCTGCTTTCGATGAGGTGTGCGCGGGT
TTCGGTGCGGACTTCCGGGAGCGTGTGTTCGCTGCTGAGGGTGGGGAGTTGGACCGTACG
GGTCTGACGCAGCCCGCGCTCTTCGCCATTGAGGTGGCGTTGTTCCGTCTGGTGGAGTCC
TTCGGTGTACGTGCGGACTTCCTGGCGGGGCATTCCATCGGGGAGTTGGCGGCGGCTCAT
GTGGCGGGTGTGCTGTCTCTTGAGGATGCCTGCACGCTGGTGGCTGCTCGTGGTCGGTTG
ATGGAGGCGCTTCCCGCGGGTGGCGCGATGGTCTCCGTGCGGGCGGCTGAGGTGGAAGTC
CGGTCGCGTATCGGGGAGTTCGAGGGCCGTGTCGACATCGCCGCGGTCAACGGCCCCGAG
TCGGTCGTGCTCTCCGGTGAGGAAGCTGCCGTTCTGGAACTCGCGGAGGCGTTGGCGGAG
TCGGGTCACAAGACGAAGCGGCTGCGTGTGTCGCATGCGTTCCATTCGCCGTTGATGGAG
CCGATGTTGGAGGAGTTCCGGCGTGTTGCGTCGGGGCTGGCGTACGGTTCGCCGTCGATT
CCGGTGGTGTCGAATCTGACCGGTGAGCTGGTGACCGCGTTCGACGCTGCGTACTGGGTG
GAGCATGTGCGCCACGCCGTGCGCTTCGCCGACGCGATCGGTTTCCTCGCCGAACGCGGC
GTACGCCACTTCCTGGAACTCGGCCCGGACGGCGTCCTGTCCGCCATGGCGCAGGAATGC
CTCCCGGAGACCTTCGAGGGGCTGCTCGTCCCGGTGCTGCGCAAGGACCGCCCGGAGGCC
GCGGCCTTCCTCGCCGCGCTCGGGGCCGCCTGGACCCGCGGCATCGCCCTCGACTGGAGC
CCGCTCCTGGACGGCACCGCCCGGGCCGCCGCCGAGCTGCCCACCTACCCCTTCCAGCGG
CAGCGCTACTGGCTGGAGGCCCCGGTCGCCGCGGCGGGTGAACAGAGCGAGGTGGACGGG
CAGTTCTGGGACGCCGTCGAGCGGGAGGACCTGGAGTCCCTGGCGGACACCCTGCGCCTG
CCGAGTGGTGACAGCGGGCTGCGCACCGTGCTGCCCGCGCTCTCCTCCTGGCGCCGCGGC
AGCCGCGAGCAGGCCGTCATCGACTCCTGGCGCTACCGGATCACCTGGAAGACCCTGCCC
GCCGGGGACACCCCGCGCCTCGACGGGACCTGGTGGATCGTGGTGCCCTCGGGCGCGAGC
GGCGCCGGGACCCTGGCCCAGGAGGCCGCCGCCGCGCTCACCGCGCACGGCGCCGTGACC
GTGCCGGTGGAACTCGACGCCACCGGGGCCGACCGCGCCCGCTGGGCCGCCGAACTCGCG
GCGCGGCAGGGCGAGTCGCCCACCGGTGTGCTCTCGCTGCTCGCGCTCGACGCCCGTCCG
CACTCCGCGCACCCCGGCGTCAGCGCCGCCCTCGCGGGTACCGCCGCCCTCGCCCAGGCC
CTCGGCGACGCGGAACTCACCGCCCCGCTGTGGAACCTCACCAGCGGCGGCGTCTCCACC
GGCCCCGGCGACCCGGCGGCCGACAGCACCGGCACCCAGGCCCAGGTCTGGGCCCTCGGC
CGGGTCGCCGCCCTCGAATACCCGGACCGCTGGGGCGGCTCGGTCGACCTGCCGCCCGCG
CCCGACGAGCGGGCCCTCGCCCGCCTGGTCTCGGTGCTCGCCGCCGGGGACGGCGAGGAC
CAGCTCGCGGTACGCGCCTCGGGTGTACGGGCCCGGCGGCTGCGCACCGCCCCGGTCCCC
GCCGACCGCAGGCCCGAGCCCTGGACGCCCACCGGCACGGTCCTGATCACCGGCGGCACC
GGCGCCCTCGGCAGCCGTCTCGCCGAGTGGCTGGCCGACCGGGGCGCCCCCCGCCTGGTG
CTGACCAGCCGCCGCGGCGCCGAGGCACCCGGCGCCCGCGAACTCGCCGCCCGGATCGAG
GAGAAGGGCACCGCGGTCACCCTCGCGGCCTGCGATGTCTCCGACCGCGAGCAGCTCACC
GGACTGCTGAAGGAGATCACCGCCGAGCAGCCGCTGACCGCGGTGGTGCACGCGGCCGGT
GTCTCCGACAACGGCTTCATGGACGAGGTCACCGGCGAACACCTGGCCCACGTACTGCGG
CCCAAGGCCCTCGCCGCCGATCTGCTGCACGAGGTCACCCTCGAACTCGGCCTGGAACTG
GAGGCGTTCGTCCTCTTCGCGTCCAGCGCGGGCATGTGGGGCAGTGGCGGCCAGGCCGCC
TACGCCGCGGCCAACGCCCACCTGGACGCGCTCGCCGAACGCCGCCGCGCGCTCGGCCTG
GCGGCCACCGCCGTCGCCTGGGGCCCCTGGGCCGAGGCGGGCATGGCGGCCTCCGAGGAC
ATCGACGAGCATCTGCGCCGCCGCGGCGTCATCGGCATCGCCCCCGCGACCGCCATCGCC
GCCCTGCAGCAGGCACTCGACCTCGACGAGTCCACGGTCGGTGTCGCCGATGTCGACTGG
TCGCTGTTCGCGCCCACCTTCACCGCGATGCGGCACAGCCCGCTGATCGCCGAACTCCCG
GCCGTCAAGGCGGCGTTGGAGGAGGACGAGCCCTCCGCCGCGGCCGACTCCGCGGCGGCC
TCCGCCCTGCTCGACAAGCTCGGCCGGGCCTCCGCGGCGGACCAGCAGCACCTCCTGGTG
GAACTCGTCCGCGCCCAGGCCGCCGCCGTCCTCGGGCACCGCACCGCCGAGGCCGTCCAG
GAGGCGCGGCCCTTCAAGGACCTCGGCTTCGACTCGCTCACCGCGGTGGAGCTGCGCAAC
CGCATCGCCACCGAGACCGGGCTCAGGCTCCCGGCCACCCTCCTGTTCGACCACCCGACC
CCCGGCGCCCTCGCCCAGCACCTGCGGAGCCACCTGGTCGTCGACGAAGCCGGCACCGAT
GCCGCCGTCCTCGCCGACCTGGACCGCCTGGACGCCGCCCTGACCCGGCTCGCCCCCGAC
GAGGCCGCGCGGCACCGCATCGCGGGCCGCCTCCAGGTACTCGTCTCCAAGTGGGGCGCC
ACCGCCCAGACCGAAGAGGAGGGCGCCCACGACGACCTGGCGTCCGCCTCGGCCGAAGAG
ATCTTCGCGCTCATCCACGACGAGCTCGGCAAGTCCTAG
[5] KS37..413
[5] AT573..881
[5] malonyl-CoA758..762
[5] ACP1006..1076
[6] KS1096..1472
[6] AT1627..1936
[6] malonyl-CoA1812..1816
[6] KR2252..2433
[6] ACP2539..2609
[5] KS109..1239
[5] AT1717..2643
[5] malonyl-CoA2272..2286
[5] ACP3016..3228
[6] KS3286..4416
[6] AT4879..5808
[6] malonyl-CoA5434..5448
[6] KR6754..7299
[6] ACP7615..7827

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [758-872]  2.8e-78 G3DSA:3.40.366.10 [1812-1926]  3.7e-77 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR006162 Phosphopantetheine attachment site (PTM)
 [1034-1049]  PS00012 [2567-2582]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1010-1075]  1.9e-09 PF00550 [2542-2608]  1.9e-13 PF00550
PF00550   PP-binding
 [1006-1076]  19.135 PS50075 [2539-2609]  21.439 PS50075
PS50075   ACP_DOMAIN
 [1005-1079]  4.5e-19 G3DSA:1.10.1200.10 [2538-2612]  6.1e-23 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [999-1113]  6.3e-29 SSF47336 [2531-2626]  4.7e-23 SSF47336
SSF47336   ACP-like
IPR013968 Polyketide synthase, KR (Domain)
 [2252-2432]  8.3e-60 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [37-288]  1.8e-98 PF00109 [1096-1347]  4.9e-94 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [297-413]  9.5e-46 PF02801 [1355-1472]  4e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [573-881]  1.1e-62 PF00698 [1627-1936]  1.6e-62 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [3-37]  2.3e-07 SSF101173
SSF101173   Docking domain B of the erythromycin polyketide synthase (DEBS)
 [5-29]  1.9e-12 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [569-874]  4.8e-74 SSF52151 [1624-1904]  1e-72 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [692-757]  2.1e-18 SSF55048 [1746-1811]  6.3e-17 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [36-298]  1e-88 G3DSA:3.40.47.10 [300-467]  1.1e-63 G3DSA:3.40.47.10 [1099-1359]  8e-86 G3DSA:3.40.47.10 [1360-1526]  6.3e-63 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [29-412]  5.8e-102 SSF53901 [1089-1471]  9.6e-106 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2514-2515]  8.1e-37 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [201-217]  PS00606 [1260-1276]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [574-863]  6.1e-119 SM00827 [1628-1917]  2e-117 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1007-1079]  6.2e-29 SM00823 [2540-2612]  2.2e-33 SM00823
SM00823   Phosphopantetheine attachment site
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [39-466]  2.9e-219 SM00825 [1099-1525]  1.1e-220 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2252-2433]  2.9e-49 SM00822
SM00822   no description
SignalP No significant hit
TMHMM No significant hit