close all open/close all

CDS information : Salino_00940


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction137,786 / 142,714 / + [in whole cluster]
137,786 / 142,714 / + [in contig]
Location137786..142714 [in whole cluster]
137786..142714 [in contig]
TypeCDS
Length4,929 bp (1,642 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I modular polyketide synthase
Gene
Gene (GenBank)salAIV
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Related Reference
ACC
H6D572
NITE
Salino3_00160
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)

close this sectionPKS/NRPS Module

7 methylmalonyl-CoA
KS34..410
AT575..893
kr1196..1373
ACP1485..1555

close this sectionSequence

selected fasta
>polyketide synthase [type I modular polyketide synthase]
MDNEKKLLDHLKWVTAELRQARQKLREAEADEPEPIAIVSMACRYPGGVRSPEDLWQLVR
EGRDAITGFPTGRGWDLASLYDADPDRLGTSYVREGGFVHDAGDFDAEFFGISPREALAM
DPQQRLLLETSWEAFERAGVDPAAVAGSRTGVFVGTTYTGYGSDREGAEENVEGHLMTGI
ATAVASGRLSYTYGFEGPAVSLDTMCSSSLVALHLAVQALRQKECTLALAGGSQIMSTPD
VYVEFSRQRGLSPDGRCKPFAAAADGTGWSEGVGVLLLERLSDARRNGHRVLAVVRGSAI
NQDGASNGLTAPNGPSQQRVIEQALANARLSPHQVDLIEAHGTGTTLGDPIEAQALLATY
GGSRPEGRPLWLGSVKSNIGHAAAAAGVAGVIKAVMAVREGVLPKSLHIDAPTPEVDWSS
GAVALLTEEREWSVPGEEPRTAAISSFGASGTNAHVLVQYAPEPDPEPAAEAPAAVFTGA
ALPWLLSGRTAEGLRGQARSLHTYASTTATALPGAALGLATTRAALERRGAVLTSGTPGT
PDKDALLTGLDALAEGTPAAGILEGTTVSGADRPVFVFPGQGSQWAGMAVELLDSSSVFA
ARLGECAEALDPFVDWSLVDVLRQTEGAPGFDRVDVVQPALWAVMVSLAEVWRAAGVAPA
AVIGHSQGEIAAAAVSGALSLSDAAKVSALRARALLALAGKGGMVSVADAADSVRERISA
WGERLALASVNGPQSTVVSGDPEALDELMAGCEAEGVRARRINVDYASHGPQVEKIRTEV
LGALSGIEPRTAEVPFLSTVTGEFVTGTELDAEYWYRNLRNTVRFEDAVRQLLDRGHGAF
VEASAHPVLTVGVQETIDAAGAPAFVQGTLRREDGDAARFLASLAEAWTRGVPVNWAIVT
DSSAPPAEDLPTYAFQRRTYWLHGARTGSVQAPVDAVEAEFWDSVENGDIDSLSGSLALE
DSAPLAELLPALSSWRRRRRERGEVDSWRYRIDWQPLAESAPPALEGTWLLVTGDGVEAE
ILKTGESALSAHGATVHPLTLTGEGEREALVRQLLGAEVEHGPFAGVLSLLATAEPERGP
ATTLALVQALADAECEAPLWVATRGAVGTGPEEAPAHPAQAGAWGLGLVAALERPGGWGG
LVDLPAEPDENLAGRLAAALAGQEDQLALRATGTYVRRLARAPLPGSEVRPWEPADTVLV
TGATAPVGARTALLLAASGAKRLLLTVPGGEEQPAALVGELEEAGVQVTLAEWDGRDVTA
LRSLAEAAAADGAPVRGVFHAATRADLAPLDETTAADLAAATAAKTVPARALDEAFGEEV
EAFVLFSSVTSYWGGGEHAAFAAASAELDALAARRRSRGLAATSVAWGVWDLFDAEQNPA
EAAELQARSADRGLPLLDPETAWQALRLSLGRQETAIAVADVDWERFWPLFTSARPAPLL
SDLPEVRGLGRGLAEDTGTGADPGAAEALRSKLAGLSPAEQDRALTDLVCAHAAAVLGHS
SAGAVDAERAFKDLGFDSLTAVGLRNGLGAATGLSLPATLVFDYPTPAAMAGYVRDHLLA
GARQEATAAGVQSGLDQLEADLLSVALDKDERKNLTRRLEGLLSRFKDAQAAADEESVSG
KLDSASDEEIFAFIREEFGRPE
selected fasta
>polyketide synthase [type I modular polyketide synthase]
ATGGACAACGAAAAGAAGCTTCTCGATCACCTCAAGTGGGTGACGGCCGAACTCCGCCAG
GCCCGGCAGAAGCTGCGCGAGGCCGAGGCGGACGAGCCCGAGCCGATCGCCATCGTCTCC
ATGGCCTGCCGCTACCCCGGTGGCGTGCGCTCGCCCGAGGACCTGTGGCAGCTGGTCCGC
GAGGGCCGGGACGCCATCACCGGCTTCCCCACCGGCCGCGGCTGGGACCTGGCCTCGCTC
TACGACGCCGACCCGGACCGGCTCGGCACCAGCTACGTACGCGAGGGCGGCTTCGTCCAC
GACGCGGGCGACTTCGACGCCGAGTTCTTCGGCATCTCCCCGCGTGAGGCGCTTGCCATG
GACCCGCAGCAGCGGCTCCTCCTGGAAACCTCCTGGGAGGCCTTCGAGCGCGCGGGCGTC
GACCCGGCCGCCGTCGCCGGCAGCCGCACCGGCGTCTTCGTCGGCACCACCTACACCGGC
TACGGCAGCGACCGGGAGGGCGCCGAGGAGAACGTCGAGGGCCACCTCATGACCGGCATC
GCGACCGCCGTCGCCTCCGGCCGGCTCTCCTACACCTACGGATTCGAGGGCCCCGCCGTC
TCCCTCGACACCATGTGCTCCTCCTCCCTGGTCGCCCTGCACCTGGCCGTCCAGGCGCTG
CGGCAGAAGGAGTGCACCCTCGCGCTCGCGGGCGGCTCGCAGATCATGTCCACGCCGGAC
GTGTACGTGGAGTTCAGCCGCCAGCGCGGCCTCTCCCCGGACGGCCGCTGCAAGCCCTTC
GCCGCCGCCGCCGACGGCACCGGCTGGTCCGAGGGGGTCGGCGTGCTGCTCCTGGAGCGG
CTCTCCGACGCCCGGCGCAACGGCCACCGGGTGCTCGCCGTGGTCCGCGGCTCCGCGATC
AACCAGGACGGCGCCTCCAACGGGCTCACCGCCCCCAACGGGCCCTCCCAGCAGCGCGTC
ATCGAGCAGGCCCTCGCCAACGCCCGGCTCTCCCCGCACCAGGTCGACCTGATCGAGGCG
CACGGCACCGGCACCACCCTCGGCGACCCCATCGAGGCGCAGGCCCTGCTCGCCACCTAC
GGCGGCAGCCGCCCGGAGGGGCGCCCGCTCTGGCTCGGCTCGGTGAAGTCGAACATCGGC
CACGCGGCCGCCGCGGCGGGTGTCGCGGGTGTCATCAAGGCGGTCATGGCGGTACGCGAG
GGCGTGCTCCCCAAGTCGCTGCACATCGACGCCCCCACCCCGGAGGTCGACTGGTCCTCC
GGCGCCGTCGCCCTGCTCACCGAGGAGCGCGAGTGGTCCGTCCCCGGTGAGGAGCCGCGC
ACCGCCGCGATCTCCTCCTTCGGCGCGAGCGGCACCAACGCCCATGTCCTCGTCCAGTAC
GCCCCCGAGCCCGACCCGGAGCCGGCGGCCGAGGCACCCGCCGCGGTCTTCACCGGCGCC
GCGCTGCCCTGGCTCCTCTCCGGCCGTACCGCCGAGGGACTGCGCGGCCAGGCCCGCTCC
CTGCACACCTACGCCTCCACCACCGCCACCGCACTCCCGGGCGCGGCCCTCGGCCTCGCC
ACCACCCGCGCCGCCCTGGAACGCCGCGGCGCGGTCCTCACCTCCGGCACCCCCGGTACC
CCCGACAAGGACGCCCTGCTCACCGGCCTGGACGCCCTCGCCGAGGGCACCCCGGCGGCC
GGGATCCTCGAAGGCACCACGGTCAGCGGCGCCGACCGCCCCGTCTTCGTCTTCCCGGGT
CAGGGTTCGCAGTGGGCGGGGATGGCGGTCGAACTCCTGGATTCCTCCTCGGTGTTCGCG
GCTCGTCTGGGGGAGTGCGCGGAGGCGCTGGACCCCTTCGTGGACTGGTCCTTGGTGGAT
GTCCTGCGGCAGACCGAGGGTGCTCCCGGTTTCGATCGCGTCGATGTGGTGCAGCCCGCG
CTCTGGGCCGTGATGGTGTCCCTCGCGGAGGTGTGGCGTGCGGCGGGTGTCGCCCCGGCC
GCGGTGATCGGTCACTCGCAGGGTGAGATCGCGGCTGCGGCGGTGTCCGGTGCGCTGTCC
CTGTCGGATGCGGCGAAGGTTTCGGCGTTGCGGGCGCGGGCGTTGCTGGCGCTGGCGGGC
AAGGGCGGGATGGTCTCGGTCGCGGATGCGGCCGATTCCGTACGGGAGCGGATCTCCGCT
TGGGGTGAGCGGCTTGCGCTCGCTTCGGTGAACGGTCCGCAGTCGACGGTGGTTTCGGGT
GATCCCGAGGCGCTGGACGAGTTGATGGCGGGCTGTGAGGCGGAGGGGGTGCGGGCCCGG
CGGATCAATGTGGACTACGCCTCGCACGGCCCCCAGGTGGAGAAGATCCGGACCGAGGTC
CTGGGCGCGCTCTCCGGTATCGAGCCGCGCACCGCCGAGGTGCCCTTCCTGTCCACGGTG
ACCGGCGAGTTTGTGACCGGCACCGAGCTGGACGCCGAGTACTGGTACCGCAACCTGCGC
AACACGGTCCGATTCGAGGACGCCGTACGGCAGTTGCTGGACCGGGGCCACGGGGCCTTC
GTGGAGGCGAGTGCCCATCCGGTGCTGACCGTCGGCGTGCAGGAGACCATCGACGCGGCG
GGCGCGCCCGCCTTCGTCCAGGGCACCCTGCGCCGCGAGGACGGCGACGCGGCCCGCTTC
CTCGCCTCCCTCGCCGAGGCCTGGACCCGTGGTGTGCCCGTCAACTGGGCCATCGTCACG
GACAGTTCGGCGCCCCCGGCCGAGGATCTGCCGACCTACGCCTTCCAGCGCCGCACCTAC
TGGCTGCACGGCGCCCGGACCGGCTCGGTCCAGGCCCCGGTGGACGCCGTGGAGGCCGAG
TTCTGGGACTCCGTGGAGAACGGGGACATCGACTCGCTCTCCGGTTCCCTCGCCCTGGAG
GACAGCGCGCCCCTGGCGGAGCTGCTCCCGGCACTCTCCTCCTGGCGGCGCCGCAGGCGG
GAGCGCGGCGAGGTCGACAGCTGGCGCTACCGGATCGACTGGCAGCCGCTGGCCGAGAGC
GCACCGCCCGCCCTGGAGGGGACCTGGCTGCTCGTCACCGGGGACGGGGTCGAGGCCGAG
ATCCTGAAGACGGGGGAGTCGGCGCTCAGCGCGCACGGCGCCACCGTGCACCCGCTGACC
CTCACGGGGGAGGGCGAACGCGAAGCCCTCGTACGGCAGTTGCTGGGCGCCGAGGTCGAG
CACGGCCCCTTCGCCGGGGTGCTCTCGCTGCTCGCCACCGCGGAGCCGGAGCGGGGGCCC
GCCACCACCCTGGCGCTCGTCCAGGCCCTGGCGGACGCGGAGTGCGAGGCGCCGCTGTGG
GTCGCCACCCGCGGCGCCGTCGGCACCGGACCCGAGGAAGCACCCGCACACCCCGCGCAG
GCGGGGGCCTGGGGCCTCGGCCTGGTCGCCGCCCTGGAGCGGCCCGGCGGCTGGGGCGGC
CTCGTCGACCTGCCCGCCGAGCCGGACGAGAACCTGGCCGGGCGGCTCGCCGCCGCGCTC
GCGGGGCAGGAGGACCAGCTCGCGCTGCGGGCCACCGGCACCTATGTGCGCCGACTGGCG
CGCGCCCCGCTGCCCGGCTCCGAGGTGCGGCCCTGGGAACCCGCCGACACCGTGCTCGTC
ACCGGCGCGACCGCGCCCGTCGGCGCCCGTACCGCCCTGCTGCTCGCGGCCTCCGGCGCC
AAGCGCCTGCTGCTCACCGTGCCCGGCGGGGAGGAGCAACCTGCCGCGCTGGTGGGGGAG
TTGGAGGAAGCCGGGGTCCAGGTCACGCTCGCGGAGTGGGACGGCCGGGACGTCACCGCG
CTGCGGTCCCTCGCGGAGGCGGCCGCCGCGGACGGCGCCCCCGTCCGCGGGGTCTTCCAC
GCCGCCACCCGGGCCGACCTCGCCCCGCTCGACGAGACCACCGCCGCCGACCTCGCCGCC
GCCACCGCGGCGAAGACCGTCCCGGCACGCGCCCTGGACGAGGCCTTCGGCGAGGAGGTC
GAGGCCTTCGTGCTGTTCTCCTCGGTCACCTCCTACTGGGGCGGCGGGGAGCACGCCGCC
TTCGCCGCCGCGAGCGCCGAGCTGGACGCGCTCGCCGCCCGCCGCCGGTCCCGCGGACTC
GCCGCCACCTCGGTGGCCTGGGGCGTCTGGGACCTCTTCGACGCCGAGCAGAACCCGGCG
GAGGCCGCCGAACTCCAGGCCCGCTCCGCGGACCGCGGACTGCCGCTGCTCGACCCCGAG
ACCGCCTGGCAGGCGCTGCGGCTCAGCCTCGGCAGGCAGGAGACCGCGATCGCCGTCGCG
GACGTGGACTGGGAGCGGTTCTGGCCGCTGTTCACCTCCGCGCGACCCGCCCCGCTGCTC
TCGGACCTGCCCGAGGTGCGCGGCCTCGGCCGGGGCCTGGCCGAGGACACCGGCACCGGG
GCCGATCCCGGCGCCGCCGAGGCCCTGCGGAGCAAGCTCGCCGGGCTCTCCCCGGCCGAA
CAGGACCGGGCCCTCACCGACCTGGTCTGCGCCCACGCCGCCGCCGTCCTCGGGCACTCC
TCCGCGGGCGCCGTCGACGCCGAACGCGCCTTCAAGGACCTCGGCTTCGACTCGCTCACC
GCGGTGGGCCTGCGCAACGGCCTGGGCGCCGCCACCGGCCTCAGCCTGCCCGCCACCCTC
GTCTTCGACTACCCGACGCCCGCCGCGATGGCCGGTTACGTACGCGATCACCTGCTGGCC
GGGGCACGCCAGGAGGCGACCGCCGCCGGGGTGCAGTCGGGCCTGGACCAGCTGGAGGCG
GACCTGCTGTCCGTCGCCCTGGACAAGGACGAACGCAAGAACCTCACCCGGCGCCTCGAA
GGACTTCTGTCCCGCTTCAAGGACGCCCAGGCCGCCGCCGACGAGGAGTCGGTGAGCGGA
AAGCTCGATTCGGCTTCCGACGAAGAGATCTTCGCCTTCATCCGTGAGGAATTCGGAAGG
CCCGAGTAG
[7] KS34..410
[7] AT575..893
[7] methylmalonyl-CoA766..770
[7] kr1196..1373
[7] ACP1485..1555
[7] KS100..1230
[7] AT1723..2679
[7] methylmalonyl-CoA2296..2310
[7] kr3586..4119
[7] ACP4453..4665

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [765-882]  2.8e-68 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR006162 Phosphopantetheine attachment site (PTM)
 [1513-1528]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1485-1555]  19.18 PS50075
PS50075   ACP_DOMAIN
 [1484-1558]  1.6e-20 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [1488-1554]  2.7e-10 PF00550
PF00550   PP-binding
 [1477-1569]  2.3e-23 SSF47336
SSF47336   ACP-like
IPR013968 Polyketide synthase, KR (Domain)
 [1197-1371]  1.1e-40 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-284]  3.4e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-410]  5.3e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [575-893]  1.1e-108 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  3.6e-12 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [573-865]  6.1e-64 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [700-765]  6.4e-18 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [36-296]  8e-88 G3DSA:3.40.47.10 [297-463]  7e-61 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [26-463]  8.1e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1196-1371]  6.8e-18 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [577-874]  3.3e-111 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1486-1558]  4e-33 SM00823
SM00823   Phosphopantetheine attachment site
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-463]  1.3e-215 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1196-1373]  7.6e-17 SM00822
SM00822   no description
SignalP No significant hit
TMHMM No significant hit