close all open/close all

CDS information : Salino_00950


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction142,767 / 154,019 / + [in whole cluster]
142,767 / 154,019 / + [in contig]
Location142767..154019 [in whole cluster]
142767..154019 [in contig]
TypeCDS
Length11,253 bp (3,750 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I modular polyketide synthase
Gene
Gene (GenBank)salAV
EC number
Keyword
Note
Note (GenBank)
  • Polyketide synthase domains: KS, AT, KR, ER, DH,ACP, KS, AT, KR, ACP
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Related Reference
ACC
H6D573
NITE
Salino3_00170
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)

close this sectionPKS/NRPS Module

8 methylmalonyl-CoA
9 ethylmalonyl-CoA
KS34..409
AT587..905
DH955..1118
ER1453..1753
KR1763..1943
ACP2047..2117
KS2141..2517
AT2682..3005
KR3308..3487
ACP3596..3666

close this sectionSequence

selected fasta
>polyketide synthase [type I modular polyketide synthase]
MAKEETLRDYLKWVTADLHDTRRRLREVEDAGHEPLAIVGMACRFPGGVSSPEDLWQLVS
EGGDAIGPFPTDRGWDLDAIYDPDPERSGRTYVREGGFLYEAGEFDPSVFGISPREAMAM
DPQQRLVLEAAWEAFERAGIDPHAMRGSRTGTFVGCYNLDYCWSLPEIPEGYEGHLTTGS
ASAVVSGRIAYTFGLEGPAVSVDTACSSGLVALHMAAQALRQDECSMALVGGVTVMSTPL
EFIGYSEQRGMAADARCKAFSAAADGMALAEGAGMLLVEKLSDAEAKGHEILAVIRGSAT
NQDGASNGLTAPNGPAQQRVIKQALANARLTTQDVDVVEAHGTGTALGDPIEAGALLATY
GQGRTGAEPLRLGSVKSNIGHTQAASGLAGVMKMVMAMRHGVLPKSLHAAEPSPHIDWTS
GAVSLLTEATPWSTPEDRPRRAAVSSFGISGTNAHVILEQHVPAAAPETAPAAPDKQPEG
APESVPGETVPAALTSALIPWTVSAKLPEALRGQAARLAEFTRGEGALRPADVAAALTRS
RAALESRGVVLAEDREGFLTALDALAEAAPAAGVIEGGTVKGADRTVFVFPGQGSQWAGM
AVELLDSSPVFASRLAECADALAPYVDWSLVDVLRQTEGAPGFDRVDVVQPALWAVMVSL
AEVWRAAGVAPAAVIGHSQGEIAAAAVAGALSLGDAAKVSALRAKALLALAGKGGMVSVA
EAADSVRERISAWGERLALASVNGPQSTVVSGDPGALDELMAACERDGVRARRINVDYAS
HGPQVEHIRAEVLSALSGIAPRTAEVPFLSTVTGEFVTGTDLDAEYWYRNLRNTVRFEDA
VRTLLDRGHGAFVEASAHPVLTVGVQETIDAVGAPAVTQGTLRRDEGGAARFLTSLAEAW
THGVPVDWDTVRPAPAPDTAVHLPTYAFQRQRYWLEVAASGAGDVAAAGLGATDHPLLGA
AVRLADGDQAVLTGRLSLRTHPWLADHAVSGTVLLPGTAFVELAVRAGDEVGLDRLDELT
LEAPLLLPEDGAVRLQLVVGPAEADARRPVSLYSAPETAEEDTAWTRHATGLLGTAGRAS
GTALTAWPPAGAEPVALEDFYERLAGAGYEYGPAFRGLASVWRVPGGEEVYAEVALDHDH
QDEAARFGLHPALLDAALHAGLVSAASGGEGVRLPFAWNGVTLHAQGATSLRVRITPAGD
EGVALEIADAAGQPVASVASLVSRPVETARLSSRPAPQDDSLFRLEWNEAGFDGEVPDPA
DWALLGEDRLDLLAAFEQLGHFPQIFDEVAVLGESVDAGLPAPGVVVLPLGGQASGGSLA
EAPGRATAQLLAVLQEWLADSRLEDSRLVVATRGAVSVRPGEDVTDLAHATAWGLLRSAQ
AENPGRILLVDLDAADPDAAGLLPRAVALAAEHTEPQAAVRAGAVLVPRLLRGPAALVPP
KDTNWQLLPGRSGTPDDLALEPVAELPLGEGEVRIAVRAAGLNFRDVMIALGMYPGEAAM
GNEAAGIVVETGPGVSRLGVGDRVMGPVPGAFGPRTTADQRLLARIPDGWSFEQAASATT
AYLTAYYALVDLAGLRAGEKVLVHAAAGGVGTAAVQLARHLGAEVFGTASKGKWAALRAA
GLDEAHLGSSRDASFAAHFAAAGPLDVVLNSLSGELTDASLGLLPDGGRFVDMGKTDIRE
PQAVAEAHPGVRYRAFDLLEAGPDRIAEILAELLPLFTSGALAPLPVRGWDIRRAGEAFR
FMAAARHTGKLVLTLPQGWDPEGTVLITGGTGTLGGLLAKHLVREQGVRQLLLTSRRGPE
APGAAELLAELADLGATARAVACDAADRGQLAAALDGIDADHPLRGVVHAAGVLDDGVIA
SLTPERLDHVMRPKSTAAAHLHELTADLDLTAFVLFSSAAGVLGGPAQGNYAAANAFLDA
LAQHRVAKGLPASSMAWGLWGEASGMTGHLDEEDVARMARSGMVAFSAEEGMRLFDAALA
SGEPLLAPVRMDSAALRAMAASGALPALARGLVRVPGRRIAQSAAEGGSAFARQIAALGA
DDRQRTLLDLVRTHAAAVLGHSGSAAVGAERAFKDLGFDSLTAVELRNRLGAATGLRLPA
TVVFDHPTPAALARQIGSELLGAAPEETVEETRTAVADDSDPVVIVGMSCRFPDGVDSPE
ALWQLVTEGRDAIGPFPTDRGWDLAGIYDPEPGIPGKSYVREGGFLHEAGQFDPELFGIS
PREALAMDPQQRLVLEGTWQVFERAGIDPAALKGSRTGVFVGAVPSGYATELAEIPDGVE
GYFGTGLSNSVITGRVAYTFGLEGPAVTVDTACSSGLVALHLAANALRQGECSMAVAGGV
AVMSTPVEFMEFGRQRALAPDARCKAFAASADGTSFSEGLGVLLLERLSDARRKGHQVLA
VVRGSATNQDGASNGLTAPSGPSQQRVIRQALANARLSALDVDAVEAHGTGTKLGDPIEA
HALLATYGQGREEERPLLLGSLKSNIGHTQAVSGIAGVIKSVMALRHGVLPRTLHVDAPS
PHIEWDQGAVELLTEERAWPETGRARRVGISSFGISGTNAHLILEQPAEAGPDGTDRAPA
RQDAPALAEVLAPTVPWPLSGKNPGALQGQAARLAAHLAEDHDLSLSDLGLSLATTRARL
EHRAVVVLGSREEALGGLGALGEQMPAGNVVTGAADLSGKTVFVFPGQGSQWAGMAVELL
DSSPVFAARFAEVAGAVEAYVDWSVESVVRGADEAPSLDRIEILQPVLFTVMVSLAALWR
AAGVVPDAVVGHSQGEIAAAAVSGALSLGDAAQVVVLRSQLFADELVGKGAVASVSLPAA
EVEARIARFNGDAELLSIAGNNGPRSVTVAGQVAALEELVAELEAEGVRAKVIGSTVASH
CAQVDPLHERILDLLSFVQPREGSVPLYSTVNGEVLNGAELDASYWFENCRRPVSFEPVV
RALFADGFDVFVESSAHPVLTYGISETAEAAGREVLAQGTLRREEGGLARFYSSLAGVWT
RGVDVDWAGAFAGRGARVVDLPTYAFQHQRYWLESGTAAAASPLADEMTAGFWTAVENED
LDALSGTVGIDAELPLRELLPALSSWRRGRHEQTTVDSWRYEVNWAPLAETSEAKLDGDW
LAVLPAGAESETKAVLDALAARGARLRTVTLDPAAPDREAWARELTEAAEQEPAGLLSLL
GLAEEREAAATGTLVLFQALTDSGLGAPLWALTRGAVATPGDGPADPVQAQLWGFGRVAA
LEQPRDWGGLVDLPEEFDERAADRLARVLAGLGDEDQVALRETGAFGRRLARAPLAGAEP
VRRWKPSGTALVTGGTGGVGAHVARWLARNGAAHLVLTSRRGAEAPGAAELAAELRKSGA
EVTLAACDVSDREQLAAVLADIPEEQPLRAVVHAVGIVQTTLIGDTTVEDYRRINAGKIR
GAEHLDALLGDTPLDAFVLFSSNSGVWGSGRHSGYAPGNAYLDAFAQRRRARGLPATSLA
WGAWGGGGMMEGEGVEEYMRKRGVLEMAPELALSAMVQAVEHEEVFRAIADVEWERFVPG
FTSGRPSPLITGIPEAVRALKATEEDSAETGAASGAAAKLAERLGAATPAERDAILLDLV
RGQVAAVLGHASGEDIEPGRAFKNLGFDSLTAVELRDRLGAATGHKLPATIVFDYPNPTA
LAQHLRAAVLPDSAQPVGSVLDELDRLEGALAASEPDSDTRTKLKKRLEALLWTWGQNPA
DTAADAEEGDLESASADDMFALLDKELGTS
selected fasta
>polyketide synthase [type I modular polyketide synthase]
ATGGCGAAAGAAGAGACGCTCCGCGATTACCTGAAGTGGGTCACGGCCGATCTGCACGAC
ACGCGCCGCCGCCTGCGGGAGGTGGAGGACGCCGGCCACGAGCCGCTGGCGATCGTCGGC
ATGGCCTGCCGCTTCCCCGGCGGGGTCTCCTCACCCGAAGACCTGTGGCAGCTGGTCTCC
GAGGGCGGCGACGCCATCGGGCCCTTCCCCACCGACCGCGGCTGGGACCTGGACGCCATC
TACGACCCGGACCCCGAGCGCTCCGGCCGCACCTATGTGCGCGAGGGCGGATTCCTCTAC
GAGGCGGGCGAGTTCGACCCCTCCGTCTTCGGGATCTCGCCGCGTGAGGCGATGGCGATG
GACCCGCAGCAGCGGCTCGTCCTGGAGGCCGCCTGGGAGGCCTTCGAGCGCGCCGGGATC
GACCCGCACGCGATGCGCGGCAGCCGCACCGGCACCTTCGTCGGCTGCTACAACCTCGAC
TACTGCTGGTCCCTGCCGGAGATCCCCGAGGGCTACGAGGGCCACCTCACCACCGGCAGC
GCCTCCGCCGTGGTCTCCGGCCGCATCGCGTACACCTTCGGGCTGGAAGGCCCGGCGGTC
TCCGTGGACACCGCCTGCTCCTCCGGTCTGGTCGCCCTGCACATGGCCGCGCAGGCGCTG
CGGCAGGACGAGTGCAGCATGGCCCTGGTCGGCGGCGTGACGGTGATGTCGACGCCGCTG
GAGTTCATCGGCTACAGCGAGCAGCGCGGCATGGCCGCCGACGCCCGCTGCAAGGCCTTC
TCCGCCGCGGCCGACGGCATGGCCCTCGCCGAGGGCGCGGGCATGCTCCTGGTCGAGAAG
CTCTCCGACGCCGAGGCCAAGGGCCACGAGATCCTCGCCGTGATCCGCGGCTCGGCCACC
AACCAGGACGGCGCCTCCAACGGCCTGACCGCCCCCAACGGCCCCGCCCAGCAGCGCGTC
ATCAAGCAGGCCCTCGCCAACGCCCGGCTCACCACCCAGGACGTGGACGTGGTCGAGGCG
CACGGCACCGGCACCGCCCTCGGCGACCCCATCGAGGCGGGCGCCCTGCTCGCCACCTAC
GGCCAGGGCCGCACCGGGGCCGAGCCGCTGCGCCTCGGCTCGGTGAAGTCCAACATCGGC
CACACCCAGGCCGCTTCGGGCCTCGCCGGTGTCATGAAGATGGTCATGGCGATGCGGCAC
GGCGTCCTGCCGAAGTCCCTGCACGCCGCCGAGCCCTCCCCGCACATCGACTGGACCTCC
GGCGCCGTCTCCCTGCTGACCGAGGCCACCCCCTGGAGCACGCCCGAGGACCGCCCGCGC
CGGGCCGCCGTCTCCTCCTTCGGCATCAGCGGCACCAACGCCCACGTCATCCTCGAACAG
CACGTCCCGGCCGCCGCGCCCGAGACCGCCCCCGCGGCCCCGGACAAGCAGCCCGAGGGC
GCCCCCGAGTCCGTACCCGGCGAGACCGTCCCGGCCGCGCTCACCAGCGCCCTCATCCCG
TGGACCGTCTCCGCGAAGCTCCCCGAGGCGCTGCGCGGACAGGCCGCCCGGCTGGCCGAG
TTCACCCGCGGTGAGGGCGCCCTGCGCCCCGCCGATGTCGCGGCGGCCCTCACCCGCAGC
CGCGCCGCCCTGGAGTCCCGGGGCGTCGTCCTCGCCGAGGACCGCGAGGGCTTCCTCACC
GCCCTGGACGCCCTTGCCGAGGCGGCACCCGCCGCCGGAGTGATCGAGGGCGGCACCGTC
AAGGGCGCCGACCGCACCGTCTTCGTCTTCCCGGGCCAGGGCTCCCAGTGGGCCGGGATG
GCGGTCGAACTCCTCGACTCCTCCCCGGTGTTCGCGAGCCGCCTCGCCGAGTGCGCGGAC
GCCCTCGCCCCGTACGTGGACTGGTCCCTGGTGGACGTCCTGCGGCAGACCGAGGGCGCC
CCCGGCTTCGACCGCGTCGACGTGGTGCAGCCCGCGCTCTGGGCGGTGATGGTCTCGCTC
GCCGAGGTGTGGCGTGCGGCGGGTGTCGCCCCGGCCGCGGTGATCGGCCACTCCCAGGGC
GAGATCGCCGCCGCGGCCGTCGCGGGCGCGCTCTCCCTCGGCGACGCCGCCAAGGTCTCG
GCGCTGCGCGCGAAGGCGCTGCTCGCGCTCGCGGGCAAGGGCGGGATGGTCTCGGTCGCC
GAGGCGGCCGACTCCGTACGGGAGCGGATCTCCGCCTGGGGCGAGCGCCTTGCCCTCGCC
TCCGTCAACGGCCCCCAGTCCACGGTGGTCTCGGGTGACCCCGGGGCCCTGGACGAGCTG
ATGGCCGCCTGCGAGCGGGACGGGGTCCGGGCCCGCCGGATCAACGTGGACTACGCCTCG
CACGGCCCCCAGGTCGAGCACATCCGCGCGGAGGTGCTGAGCGCGCTCTCCGGCATCGCG
CCGCGCACCGCCGAGGTGCCCTTCCTGTCCACGGTCACCGGCGAGTTCGTCACCGGCACC
GACCTGGACGCCGAGTACTGGTACCGCAACCTGCGCAACACCGTCCGCTTCGAGGACGCC
GTACGCACCCTGCTCGACCGCGGCCACGGCGCCTTCGTGGAGGCGAGCGCCCACCCGGTG
CTGACCGTCGGCGTGCAGGAGACCATCGACGCGGTGGGCGCCCCCGCGGTCACCCAGGGC
ACCCTGCGCCGCGACGAGGGCGGCGCCGCCCGCTTCCTCACCTCGCTGGCCGAGGCCTGG
ACCCACGGCGTGCCCGTCGACTGGGACACCGTGCGCCCCGCGCCCGCCCCGGACACCGCC
GTCCACCTGCCCACCTACGCCTTCCAGCGGCAGCGCTACTGGCTGGAGGTCGCCGCGAGC
GGCGCCGGCGACGTCGCCGCGGCCGGGCTCGGCGCCACCGACCACCCGCTGCTCGGCGCC
GCGGTCCGCCTCGCCGACGGCGACCAGGCCGTGCTGACCGGACGCCTCTCGCTGCGCACC
CACCCCTGGCTCGCCGACCACGCGGTCAGCGGCACCGTGCTGCTCCCCGGCACCGCCTTC
GTCGAGCTCGCGGTGCGCGCGGGCGACGAGGTCGGCCTCGACCGCCTCGACGAACTCACC
CTGGAAGCACCCCTGTTGCTCCCCGAGGACGGGGCGGTGCGGCTCCAGCTCGTGGTCGGC
CCCGCGGAGGCCGACGCGCGCAGGCCGGTGAGCCTGTACTCGGCGCCCGAGACCGCCGAG
GAGGACACCGCCTGGACCCGGCACGCCACCGGACTCCTCGGCACCGCGGGCCGCGCCTCC
GGCACCGCGCTGACCGCCTGGCCCCCGGCGGGCGCCGAGCCGGTCGCCCTGGAGGACTTC
TACGAGCGGCTCGCGGGCGCCGGATACGAGTACGGCCCGGCCTTCCGCGGACTGGCCTCG
GTCTGGCGGGTCCCCGGCGGCGAGGAGGTCTACGCCGAGGTCGCCCTCGACCACGACCAC
CAGGACGAGGCCGCCCGCTTCGGCCTGCACCCCGCCCTGCTCGACGCCGCCCTGCACGCC
GGTCTCGTCTCCGCGGCCTCCGGCGGCGAGGGCGTCCGGCTGCCCTTCGCCTGGAACGGC
GTCACCCTGCACGCCCAGGGCGCCACCTCGCTGCGGGTGCGGATCACCCCGGCCGGGGAC
GAGGGCGTCGCCCTGGAGATCGCGGACGCCGCCGGACAGCCGGTCGCCTCGGTGGCCTCG
CTCGTCTCCCGGCCGGTGGAGACCGCTCGGCTGAGTAGCCGCCCCGCCCCGCAGGACGAC
TCGCTGTTCCGCCTGGAGTGGAACGAGGCCGGATTCGACGGCGAGGTGCCCGACCCGGCC
GACTGGGCGCTCCTCGGCGAGGACCGCCTCGACCTGCTCGCCGCCTTCGAGCAGCTCGGC
CACTTCCCGCAGATCTTCGACGAGGTCGCCGTGCTCGGCGAGAGCGTCGACGCCGGACTG
CCCGCCCCCGGGGTCGTCGTGCTGCCGCTCGGCGGCCAGGCCTCCGGCGGCTCGCTCGCC
GAGGCGCCGGGCCGGGCCACGGCGCAGCTCCTCGCCGTGCTCCAGGAGTGGCTGGCCGAC
AGCCGCCTGGAGGACTCCCGCCTGGTGGTCGCCACCCGCGGCGCCGTCTCGGTACGCCCC
GGCGAGGACGTCACCGACCTCGCCCACGCCACCGCCTGGGGCCTGCTCCGCTCCGCGCAG
GCGGAGAACCCGGGCCGCATCCTCCTGGTCGACCTGGACGCCGCCGACCCGGACGCGGCC
GGTCTGCTCCCGCGCGCCGTCGCCCTCGCCGCCGAGCACACCGAACCGCAGGCCGCCGTC
CGCGCGGGCGCGGTGCTCGTCCCGCGCCTGCTGCGCGGACCCGCCGCCCTGGTGCCGCCG
AAGGACACCAACTGGCAGCTGCTTCCCGGGCGTTCGGGCACCCCCGACGACCTCGCCCTG
GAACCGGTGGCCGAACTCCCGCTCGGTGAGGGCGAGGTACGGATCGCGGTCCGCGCCGCC
GGCCTCAACTTCCGCGATGTGATGATCGCCCTCGGCATGTACCCGGGCGAGGCCGCCATG
GGCAACGAGGCCGCGGGCATCGTCGTCGAGACCGGCCCCGGCGTCTCCCGACTCGGTGTC
GGCGACCGCGTGATGGGCCCGGTGCCCGGCGCCTTCGGCCCCCGCACCACCGCCGACCAG
CGCCTGCTCGCCCGCATCCCGGACGGCTGGAGCTTCGAGCAGGCCGCCTCCGCCACCACC
GCCTACCTCACCGCCTACTACGCCCTGGTCGACCTCGCCGGGCTGCGCGCGGGCGAGAAG
GTCCTCGTGCACGCCGCGGCGGGCGGCGTCGGCACCGCCGCCGTCCAGCTCGCCCGCCAC
CTCGGCGCCGAGGTCTTCGGCACCGCCAGCAAGGGCAAGTGGGCGGCACTGCGCGCGGCC
GGACTCGACGAGGCCCACCTCGGCTCCTCCCGGGACGCCTCCTTCGCCGCGCACTTCGCG
GCGGCCGGCCCCCTGGACGTCGTACTGAACTCGCTCAGCGGCGAACTCACGGACGCCTCC
CTGGGGTTGCTGCCGGACGGCGGGCGCTTCGTCGACATGGGCAAGACCGACATCCGCGAG
CCGCAGGCCGTGGCCGAGGCCCACCCGGGCGTCCGCTACCGGGCCTTCGACCTCCTGGAG
GCGGGCCCGGACCGGATCGCGGAGATCCTCGCCGAACTGCTGCCGCTGTTCACCTCCGGC
GCGCTCGCCCCGCTGCCGGTACGCGGCTGGGACATCCGGCGCGCGGGCGAGGCCTTCCGC
TTCATGGCCGCCGCCCGGCACACCGGCAAGCTGGTCCTGACCCTCCCGCAGGGCTGGGAC
CCCGAGGGCACCGTCCTGATCACCGGCGGCACCGGCACCCTCGGCGGACTGCTCGCCAAG
CACCTCGTACGGGAGCAGGGCGTACGGCAGCTGCTGCTGACCAGCCGCCGCGGGCCCGAG
GCCCCCGGCGCCGCCGAACTCCTCGCCGAACTGGCCGACTTGGGCGCCACGGCCCGGGCG
GTGGCCTGCGACGCCGCCGACCGCGGACAGCTCGCCGCGGCCCTCGACGGCATCGACGCG
GACCACCCGCTGCGCGGTGTGGTGCACGCCGCCGGTGTCCTCGACGACGGTGTGATCGCC
TCGCTCACCCCGGAGCGGCTCGACCACGTCATGCGGCCCAAGTCCACGGCGGCGGCCCAT
CTGCACGAGCTGACCGCCGATCTGGACCTGACCGCCTTCGTCCTCTTCTCCTCGGCGGCC
GGTGTCCTCGGCGGCCCCGCCCAGGGCAACTACGCGGCGGCCAACGCCTTCCTGGACGCC
CTCGCCCAGCACCGGGTGGCGAAGGGGCTGCCCGCCTCCTCGATGGCCTGGGGCCTGTGG
GGCGAGGCCAGCGGCATGACCGGGCACCTCGACGAGGAGGACGTCGCCCGGATGGCCCGC
TCCGGCATGGTCGCCTTCTCCGCCGAGGAGGGTATGCGGCTCTTCGACGCGGCCCTCGCC
AGCGGCGAACCCCTGCTGGCCCCGGTCCGCATGGACAGCGCCGCCCTGCGCGCGATGGCC
GCCTCCGGCGCCCTCCCCGCGCTCGCCCGCGGTCTTGTCCGCGTGCCGGGCCGCCGGATC
GCCCAGTCCGCGGCCGAGGGCGGCTCCGCCTTCGCTCGCCAGATCGCCGCCCTCGGCGCC
GACGACCGGCAGCGCACCCTGCTCGACCTGGTCCGCACCCACGCCGCCGCCGTCCTCGGC
CACAGCGGCAGCGCCGCCGTCGGCGCCGAACGCGCCTTCAAGGACCTCGGCTTCGACTCG
CTCACCGCCGTCGAACTGCGCAACCGGCTCGGCGCCGCCACCGGACTGCGCCTTCCCGCG
ACCGTCGTCTTCGACCACCCCACCCCCGCCGCGCTCGCCCGGCAGATCGGCTCCGAACTC
CTCGGCGCCGCACCGGAGGAGACCGTCGAGGAGACCCGTACCGCGGTCGCCGACGACAGC
GACCCGGTGGTCATCGTCGGCATGTCCTGCCGCTTCCCGGACGGCGTGGACTCGCCGGAG
GCGCTGTGGCAGCTGGTCACCGAGGGCCGCGACGCCATCGGACCCTTCCCCACCGACCGC
GGCTGGGACCTCGCCGGAATCTACGACCCCGAGCCCGGCATCCCCGGCAAGAGCTATGTG
CGCGAGGGCGGATTCCTGCACGAGGCGGGCCAGTTCGACCCCGAGCTGTTCGGGATCTCC
CCGCGCGAGGCCCTGGCGATGGACCCGCAGCAGCGGCTCGTCCTGGAAGGAACCTGGCAG
GTCTTCGAGCGCGCGGGCATCGACCCCGCCGCGCTCAAGGGCAGCAGGACCGGCGTCTTC
GTCGGCGCGGTGCCCTCCGGCTACGCCACCGAACTCGCCGAGATCCCGGACGGTGTCGAG
GGCTACTTCGGCACCGGCCTGTCCAACAGCGTCATCACCGGCCGCGTCGCCTACACCTTC
GGACTCGAAGGCCCCGCGGTCACCGTCGACACCGCCTGCTCCTCGGGCCTGGTCGCCCTG
CACCTCGCCGCCAACGCGCTGCGCCAGGGCGAGTGCAGCATGGCCGTCGCCGGGGGTGTG
GCCGTGATGTCCACCCCGGTGGAGTTCATGGAGTTCGGCCGCCAGCGCGCGCTCGCCCCG
GACGCCCGCTGCAAGGCCTTCGCCGCCTCCGCCGACGGCACCAGCTTCTCCGAGGGCCTC
GGCGTGCTCCTCCTGGAACGCCTCTCCGACGCCCGCCGCAAGGGCCACCAGGTCCTCGCC
GTGGTCCGCGGCTCGGCCACCAACCAGGACGGCGCCTCCAACGGCCTCACCGCCCCGAGC
GGCCCCTCCCAGCAGCGGGTGATCCGCCAGGCCCTCGCCAACGCCCGCCTCTCCGCGCTC
GACGTGGACGCGGTCGAGGCCCACGGCACCGGTACGAAGCTGGGCGACCCCATCGAGGCG
CACGCCCTGCTCGCCACCTACGGCCAGGGCCGCGAGGAGGAACGCCCGCTGCTGCTCGGT
TCGTTGAAGTCCAACATCGGCCACACCCAGGCCGTCTCCGGCATCGCGGGCGTCATCAAG
TCCGTGATGGCGCTCCGGCACGGCGTACTGCCGAGGACCCTGCACGTGGACGCGCCCTCC
CCGCACATCGAGTGGGACCAGGGCGCGGTGGAACTGCTCACCGAGGAGCGGGCCTGGCCC
GAGACCGGCCGCGCCCGCCGCGTCGGCATCTCCTCCTTCGGCATCAGCGGCACCAACGCC
CACCTCATCCTGGAGCAGCCCGCCGAAGCCGGGCCGGACGGCACGGACCGCGCGCCCGCC
CGCCAGGACGCCCCCGCCCTCGCGGAGGTGCTCGCCCCGACCGTCCCCTGGCCGCTGTCC
GGCAAGAACCCCGGCGCCCTCCAGGGCCAGGCCGCCCGGCTCGCCGCCCACCTGGCCGAG
GACCACGACCTCTCCCTCTCCGACCTCGGCCTCTCCCTCGCCACCACCCGCGCCCGGCTC
GAACACCGCGCGGTCGTCGTCCTCGGCAGCCGCGAGGAGGCCCTCGGCGGCCTCGGCGCC
CTGGGCGAGCAGATGCCCGCGGGCAATGTCGTCACCGGCGCCGCGGACCTCTCCGGCAAG
ACGGTGTTCGTCTTCCCGGGTCAGGGTTCGCAGTGGGCCGGTATGGCGGTCGAACTCCTG
GACTCCTCCCCGGTGTTCGCGGCCCGGTTCGCCGAAGTCGCGGGCGCTGTCGAGGCGTAC
GTGGACTGGTCGGTGGAGTCGGTCGTACGGGGTGCGGACGAGGCCCCGTCGCTCGACCGC
ATCGAGATCCTTCAGCCGGTGCTGTTCACCGTGATGGTGTCGCTGGCCGCGCTGTGGCGC
GCCGCCGGTGTGGTGCCGGACGCGGTGGTCGGTCACTCGCAGGGTGAGATCGCGGCTGCT
GCCGTGTCCGGCGCTCTGTCGCTTGGGGATGCGGCTCAAGTGGTGGTGCTGCGTTCGCAG
TTGTTCGCGGATGAGTTGGTCGGCAAGGGTGCGGTGGCGTCGGTTTCCTTGCCTGCGGCT
GAAGTCGAGGCGCGTATCGCGCGCTTCAACGGTGACGCTGAGCTGTTGTCGATCGCGGGG
AACAATGGTCCGCGTTCGGTGACGGTCGCGGGTCAAGTCGCGGCTCTGGAAGAGCTGGTG
GCCGAGTTGGAGGCCGAGGGTGTCCGGGCGAAGGTGATCGGCTCCACGGTCGCCTCGCAC
TGCGCTCAGGTGGACCCGCTGCACGAGCGGATCCTCGACCTGCTGTCGTTCGTGCAGCCG
CGTGAGGGCTCCGTTCCGCTGTACTCGACGGTCAACGGCGAGGTGCTGAACGGCGCCGAG
TTGGACGCTTCGTACTGGTTCGAGAACTGCCGCCGCCCGGTCAGCTTCGAGCCGGTCGTA
CGCGCCCTGTTCGCCGACGGCTTCGACGTGTTCGTGGAGTCGAGTGCGCACCCGGTGCTG
ACCTACGGCATCAGCGAGACCGCCGAGGCCGCGGGCCGGGAGGTCCTCGCGCAGGGCACC
CTGCGGCGCGAGGAGGGCGGGCTCGCCCGGTTCTACAGCTCCCTCGCGGGGGTCTGGACC
CGGGGCGTGGACGTCGACTGGGCCGGGGCCTTCGCCGGGCGCGGGGCCCGGGTGGTCGAC
CTGCCGACCTACGCCTTCCAGCACCAGCGCTACTGGCTGGAGTCCGGCACCGCCGCCGCG
GCCTCGCCGCTCGCGGACGAGATGACCGCCGGGTTCTGGACCGCGGTGGAGAACGAGGAC
CTGGACGCCCTCTCCGGCACCGTCGGCATCGACGCGGAGCTGCCGCTGCGCGAACTCCTC
CCGGCGCTGTCCTCCTGGCGCCGCGGCCGCCACGAGCAGACCACCGTCGACTCCTGGCGC
TACGAGGTCAACTGGGCGCCGCTGGCCGAGACGTCGGAGGCGAAGCTCGACGGGGACTGG
CTGGCCGTACTGCCCGCCGGGGCCGAGAGCGAGACCAAGGCCGTCCTCGACGCGCTCGCG
GCGCGCGGCGCCCGGCTGCGTACCGTGACGCTCGACCCGGCCGCGCCCGACCGCGAGGCC
TGGGCCCGGGAGCTGACCGAGGCGGCGGAGCAGGAACCGGCCGGGCTGCTCTCGCTGCTC
GGTCTCGCCGAGGAGCGGGAGGCGGCGGCCACCGGCACCCTGGTGCTCTTCCAGGCGCTC
ACCGACTCCGGTCTGGGCGCCCCGCTGTGGGCGCTCACCCGGGGCGCGGTCGCCACCCCG
GGCGACGGGCCCGCCGACCCGGTGCAGGCGCAGCTGTGGGGCTTCGGACGGGTCGCCGCC
CTCGAACAGCCCCGCGACTGGGGCGGTCTGGTCGATCTGCCGGAGGAGTTCGACGAGCGG
GCCGCCGACCGGCTCGCCCGGGTGCTCGCCGGTCTCGGCGACGAGGACCAGGTGGCGCTG
CGCGAGACCGGCGCCTTCGGCCGCCGCCTGGCCCGCGCCCCGCTGGCCGGTGCCGAGCCG
GTACGCCGGTGGAAGCCCTCCGGCACCGCCCTGGTCACCGGCGGCACCGGCGGTGTCGGC
GCCCATGTCGCCCGCTGGCTGGCCCGCAACGGCGCCGCCCACCTGGTGCTGACCAGCCGC
CGCGGGGCCGAGGCCCCCGGCGCGGCCGAACTCGCCGCGGAACTGCGGAAGTCGGGCGCC
GAGGTCACCCTCGCCGCCTGCGATGTCTCCGACCGGGAGCAGCTGGCCGCGGTCCTCGCG
GACATCCCCGAGGAGCAGCCGCTGCGGGCCGTGGTGCACGCGGTCGGCATCGTGCAGACC
ACCCTCATCGGGGACACCACCGTCGAGGACTACCGGCGCATCAACGCGGGCAAGATCCGC
GGCGCCGAGCACCTGGACGCCCTGCTCGGGGACACCCCGCTCGACGCCTTCGTGCTCTTC
TCCTCCAACTCCGGGGTCTGGGGCAGCGGCCGGCACAGCGGCTACGCCCCCGGCAACGCC
TACCTGGACGCCTTCGCCCAGCGGCGCCGGGCCCGCGGCCTGCCCGCCACCTCGCTGGCC
TGGGGTGCCTGGGGCGGCGGCGGCATGATGGAGGGCGAGGGCGTCGAGGAGTACATGCGC
AAGCGCGGTGTCCTGGAGATGGCACCGGAACTCGCCCTCTCCGCCATGGTCCAGGCCGTG
GAGCACGAGGAGGTCTTCCGGGCCATCGCCGACGTGGAGTGGGAGCGCTTCGTCCCCGGC
TTCACCTCCGGCCGCCCGAGCCCGCTGATCACCGGCATCCCGGAGGCCGTGCGGGCGCTG
AAGGCCACCGAGGAGGACAGCGCGGAGACCGGTGCCGCGAGCGGGGCCGCCGCGAAGCTC
GCCGAGCGGCTCGGCGCCGCGACCCCGGCCGAGCGGGACGCCATCCTGCTCGACCTGGTA
CGCGGACAGGTCGCCGCCGTCCTCGGGCACGCCTCCGGGGAGGACATCGAACCCGGGCGG
GCCTTCAAGAACCTGGGCTTCGACTCGCTCACCGCGGTCGAGCTGCGGGACCGCCTCGGC
GCCGCCACCGGCCACAAGCTCCCGGCCACCATCGTCTTCGACTACCCCAACCCGACCGCC
CTCGCCCAGCACCTGCGGGCCGCCGTCCTGCCCGACTCGGCGCAGCCCGTCGGCTCCGTA
CTCGACGAACTCGACCGCCTGGAAGGGGCGTTGGCCGCCTCCGAGCCGGACAGCGACACC
CGCACCAAGCTGAAGAAGCGGCTCGAAGCACTGCTGTGGACCTGGGGCCAGAACCCCGCC
GACACCGCAGCGGACGCCGAAGAAGGCGACCTGGAGTCGGCCTCCGCCGACGACATGTTC
GCCCTGCTCGACAAAGAGCTCGGCACCTCCTGA
[8] KS34..409
[8] AT587..905
[8] methylmalonyl-CoA778..782
[8] DH955..1118
[8] ER1453..1753
[8] KR1763..1943
[8] ACP2047..2117
[9] KS2141..2517
[9] AT2682..3005
[9] ethylmalonyl-CoA2877..2881
[9] KR3308..3487
[9] ACP3596..3666
[8] KS100..1227
[8] AT1759..2715
[8] methylmalonyl-CoA2332..2346
[8] DH2863..3354
[8] ER4357..5259
[8] KR5287..5829
[8] ACP6139..6351
[9] KS6421..7551
[9] AT8044..9015
[9] ethylmalonyl-CoA8629..8643
[9] KR9922..10461
[9] ACP10786..10998

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [777-895]  3.3e-70 G3DSA:3.40.366.10 [2876-2992]  5e-65 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [1578-1599]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [2075-2090]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [2047-2117]  20.503 PS50075 [3596-3666]  18.884 PS50075
PS50075   ACP_DOMAIN
 [2040-2157]  3.2e-26 SSF47336 [3588-3683]  6.7e-22 SSF47336
SSF47336   ACP-like
 [2044-2120]  3.6e-21 G3DSA:1.10.1200.10 [3596-3668]  7.3e-18 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [2050-2116]  7.4e-12 PF00550 [3599-3665]  1.6e-10 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [1441-1585]  5.1e-36 SSF50129
SSF50129   GroES-like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1471-1526]  1.8e-08 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1763-1942]  1.5e-62 PF08659 [3308-3486]  9e-62 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-284]  1.8e-92 PF00109 [2141-2391]  2.6e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-409]  3.8e-47 PF02801 [2399-2517]  4.6e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [587-905]  3.2e-107 PF00698 [2682-3005]  7.6e-90 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [4-34]  1.8e-06 SSF101173
SSF101173   Docking domain B of the erythromycin polyketide synthase (DEBS)
 [1-27]  1.3e-13 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [585-887]  4.5e-66 SSF52151 [2680-2986]  1.6e-61 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [712-777]  7.4e-18 SSF55048 [2808-2876]  4e-12 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [37-296]  7.5e-85 G3DSA:3.40.47.10 [297-461]  3.2e-62 G3DSA:3.40.47.10 [2143-2403]  1.1e-88 G3DSA:3.40.47.10 [2404-2568]  1.7e-61 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [26-408]  4.6e-101 SSF53901 [2133-2569]  5.5e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1542-1726]  1.1e-43 G3DSA:3.40.50.720 [1763-1961]  1.4e-34 G3DSA:3.40.50.720 [3308-3530]  4.7e-36 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606 [2304-2320]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [589-886]  1.3e-112 SM00827 [2684-2985]  2.4e-96 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [2048-2120]  4.5e-33 SM00823 [3597-3669]  4.5e-30 SM00823
SM00823   Phosphopantetheine attachment site
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [955-1118]  8.4e-87 SM00826
SM00826   no description
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-463]  2.6e-211 SM00825 [2143-2569]  1.2e-213 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1763-1943]  7e-61 SM00822 [3308-3487]  8.1e-51 SM00822
SM00822   no description
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1453-1753]  3.6e-170 SM00829
SM00829   Enoylreductase
SignalP No significant hit
TMHMM No significant hit