close all open/close all

CDS information : Salino_00960


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction154,134 / 158,441 / + [in whole cluster]
154,134 / 158,441 / + [in contig]
Location154134..158441 [in whole cluster]
154134..158441 [in contig]
TypeCDS
Length4,308 bp (1,435 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I modular polyketide synthase
Gene
Gene (GenBank)salAVI
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Related Reference
ACC
H6D574
NITE
Salino3_00180
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)

close this sectionPKS/NRPS Module

10 methylmalonyl-CoA
KS38..414
AT585..904
DH952..1115
ACP1281..1351

close this sectionSequence

selected fasta
>polyketide synthase [type I modular polyketide synthase]
MANHANNEEKLLEYLKRATADLQQTRKRLQAVQAAEHEPIALVGMACRYPGDADSPEALW
DLVAKGQDAVGAFPGNRGWDIESRYSADPDVPGSNYVREGAFLYDVDEFDADFFGINPRE
ALAMDPQQRLLLETGWEAVERAGIDPLSLTGSATGTFVGFSAMDYTSGMTEVPEEVEGYI
GTGNLASVMSGRLSYSLGLEGPAVTIDTACSSSLVAMHMAAQALRAGECSMALAGGVTVM
SNQAGFIEFSRQRALAPDGRCKAFAAAADGFGPSEGAGIVVMERLSDAQRAGRRILAVLR
GSAVNQDGASNGLTAPNGPSQVRVIRQALANARVPAAEVDAVEGHGTGTTLGDPIEAQAL
LATYGQNRPEGQPLWLGSLKSNIGHTSAASGVASVMKMVMAMRNGLLPQTLHVDAPSPKI
DWDSGAVELLTEARDWPRTGRPRRAGVSAFGISGTNAHVILEEAPATEAPAEGAEASDPA
ADSASGEAAPALLSRLGTTVPWLLSGRTAKALRGQAERLRRYAATGDLDATATGVALATS
RSAFDHRAAVAAPGHEDTLRGLAALAEGDLAAGALQGRDQGGKSVFVFPGQGSQWAGMAV
ELLDSSPVFAARLGECAQALDPFVDWSLVDVLRQTEGAPGFDRVDVVQPALWAVMVSLAE
VWRAAGVAPAAVIGHSQGEIAAAAVSGALSLSDAAKVSALRARALLALAGKGEMVSVADA
AGSVRKRISAWGERLALASVNGPQSTVVSGDPEALDELMAACEAEGVRARRINVDYASHG
PQVEQIREEVLGLLDGIQPRAAEVPFLSTVTGEFVTGTELDAEYWYRNLRNTVRFEDAVR
QLLTSGHSLFLEASAHPVLTVGVQESIDAAGAAATSQGTLRREEGGPDRLLASLAEAWAH
GAAVDWRLVYAGHEASGADLPTYAFQRQRYWLDVAAAAAADVTAAGLGATDHPLLGAAVR
LAEGNQTVLTGRLSLRTHPWLGDHVVSGVRVLPGGAFVELAVRAGDEAGCDRLTELALET
PMVIPAEGAVQVQVVVGPESDTGRAVTVYGRPESAGDAGEWTRHAHGRLERSDSPEGGTE
LTAWPPSGAERVDLDGFYEGLHQQGYGYGPVFQGLADVWLAGDGGGVFAEVTLPAEQQED
AGRFGLHPALLDSALHALAVSGPEAEEGTAWLPYAFTGLRLYAAGATRVRVHLKPVGPEE
VALVVADVTGRPVATVDSFASRLVSGAELRALADAVAGGTAAAVLPGAPLRRAAAGQDDA
EAESFTARLAAMGPEEQERALTDLVRSRVAAVLGHGESETVEAERAFRDLGFDSLTAVEL
RNRLTAATGLSLPATLVFSHPTPLALARHLLDQLGTAGAAEGPVAREFAALEAALSAEAP
EGEDREAVVGRLEALLWRWRERSGSGSGGVIESGALDSVSDDEIFDLIDKELGAS
selected fasta
>polyketide synthase [type I modular polyketide synthase]
ATGGCGAACCACGCGAACAACGAAGAGAAACTGCTCGAATACCTCAAGCGGGCCACGGCC
GATCTGCAGCAGACCCGCAAGCGCCTGCAGGCCGTCCAGGCGGCGGAGCACGAGCCCATC
GCCCTCGTCGGCATGGCCTGCCGCTACCCCGGCGACGCCGACTCTCCCGAGGCGCTGTGG
GACCTGGTGGCCAAGGGCCAGGACGCGGTGGGCGCCTTCCCCGGCAACCGCGGCTGGGAC
ATCGAGTCCCGCTACAGCGCGGACCCCGACGTCCCCGGCAGCAACTACGTACGGGAGGGC
GCCTTCCTCTACGACGTGGACGAGTTCGACGCCGACTTCTTCGGGATCAACCCGCGTGAG
GCGCTCGCCATGGACCCGCAGCAGCGGCTGCTCCTGGAGACCGGCTGGGAGGCCGTGGAG
CGCGCGGGCATCGACCCGCTGAGCCTGACCGGCAGCGCCACCGGCACCTTCGTCGGCTTC
AGCGCCATGGACTACACCTCGGGCATGACCGAGGTGCCCGAGGAGGTCGAGGGCTACATC
GGCACCGGCAACCTCGCCAGCGTCATGTCGGGCCGGCTCTCGTACTCCCTCGGTCTCGAA
GGCCCGGCGGTCACCATCGACACCGCCTGCTCCTCCTCGCTCGTCGCCATGCACATGGCC
GCGCAGGCGCTGCGGGCGGGGGAGTGCTCCATGGCCCTGGCGGGCGGCGTCACCGTGATG
TCCAACCAGGCCGGGTTCATCGAGTTCAGCCGTCAGCGGGCGCTCGCCCCGGACGGCCGC
TGCAAGGCCTTCGCCGCCGCGGCCGACGGCTTCGGGCCCTCGGAGGGCGCCGGGATCGTC
GTCATGGAGCGCCTCTCCGACGCCCAGCGCGCGGGCCGCCGGATCCTCGCCGTGCTGCGC
GGCTCCGCCGTCAACCAGGACGGCGCCTCCAACGGCCTCACCGCCCCCAACGGCCCCTCC
CAGGTACGCGTCATCCGGCAGGCCCTCGCCAACGCCCGGGTGCCCGCCGCCGAGGTCGAC
GCGGTCGAGGGCCACGGCACCGGCACCACCCTCGGCGACCCCATCGAGGCGCAGGCCCTG
CTCGCCACCTACGGCCAGAACCGGCCGGAGGGGCAGCCGCTCTGGCTCGGCTCGCTGAAG
TCGAACATCGGCCACACCTCGGCCGCCTCGGGTGTCGCCAGCGTCATGAAGATGGTCATG
GCCATGCGCAACGGCCTGCTCCCGCAGACCCTGCACGTGGACGCGCCCTCGCCGAAGATC
GACTGGGACTCCGGCGCCGTCGAACTCCTCACCGAGGCCCGCGACTGGCCCCGCACCGGC
CGCCCCCGCCGCGCCGGTGTCTCCGCCTTCGGCATCAGCGGCACCAACGCCCACGTCATC
CTCGAAGAGGCCCCGGCGACGGAGGCCCCGGCCGAGGGCGCCGAGGCGAGCGACCCCGCC
GCGGACTCCGCCAGCGGCGAGGCGGCCCCGGCGCTCCTGTCCCGGCTCGGCACTACGGTG
CCCTGGCTGCTCTCCGGACGGACCGCCAAGGCCCTGCGCGGGCAGGCCGAACGGCTCCGC
CGGTACGCGGCCACCGGCGACCTCGACGCCACCGCCACCGGTGTCGCCCTCGCCACCTCG
CGGTCCGCCTTCGACCACCGCGCCGCCGTCGCCGCCCCCGGCCACGAGGACACCCTCCGC
GGCCTGGCGGCCCTCGCCGAGGGCGACCTCGCCGCCGGCGCGCTCCAGGGCCGCGACCAG
GGCGGCAAGTCCGTCTTCGTCTTCCCGGGTCAGGGTTCGCAGTGGGCGGGGATGGCGGTC
GAACTCCTCGATTCCTCCCCGGTGTTCGCGGCTCGTCTGGGGGAGTGCGCGCAGGCGCTG
GACCCCTTCGTGGACTGGTCCCTGGTGGATGTCCTGCGGCAGACCGAGGGCGCCCCCGGC
TTCGACCGCGTCGATGTGGTGCAGCCCGCGCTGTGGGCGGTGATGGTGTCGCTTGCCGAG
GTGTGGCGTGCGGCGGGTGTCGCCCCGGCCGCGGTGATCGGTCACTCGCAGGGCGAGATC
GCGGCTGCGGCGGTGTCCGGTGCGTTGTCCCTGTCGGATGCGGCGAAGGTTTCGGCGTTG
CGGGCGCGGGCGTTGCTGGCGCTGGCGGGCAAGGGCGAGATGGTCTCGGTCGCGGATGCG
GCCGGTTCCGTACGGAAGCGGATCTCCGCTTGGGGTGAGCGGCTTGCGCTCGCTTCGGTG
AACGGTCCGCAGTCGACGGTGGTTTCGGGTGATCCCGAGGCGCTGGACGAGTTGATGGCG
GCCTGTGAGGCGGAGGGGGTGCGGGCCCGGCGGATCAATGTGGACTACGCCTCGCACGGC
CCCCAGGTCGAGCAGATCCGCGAGGAAGTGCTCGGCCTCCTGGACGGTATTCAGCCACGC
GCTGCCGAGGTGCCGTTCCTGTCCACGGTGACTGGTGAGTTCGTGACCGGCACCGAGCTG
GACGCCGAGTACTGGTACCGCAACCTGCGCAACACGGTCCGATTCGAGGACGCCGTACGG
CAGTTGCTGACCTCGGGGCACAGCCTGTTCCTGGAGGCCAGCGCGCACCCGGTGCTCACC
GTGGGCGTGCAGGAGAGCATCGACGCCGCCGGTGCCGCCGCCACCTCGCAGGGCACCCTG
CGCCGCGAGGAGGGCGGCCCCGACCGGCTGCTCGCCTCCCTCGCGGAGGCCTGGGCGCAC
GGTGCCGCGGTCGACTGGCGCCTGGTCTACGCCGGGCACGAGGCCTCCGGCGCCGACCTG
CCCACGTACGCCTTCCAGCGGCAGCGGTACTGGCTGGATGTCGCCGCCGCGGCCGCCGCC
GATGTCACCGCGGCGGGGCTCGGCGCCACCGACCACCCCCTGCTCGGCGCCGCGGTCCGG
CTCGCCGAGGGCAACCAGACCGTGCTGACCGGGCGGCTCTCGCTGCGCACCCACCCCTGG
CTCGGCGACCACGTGGTCTCCGGGGTGCGGGTGCTGCCGGGCGGCGCCTTCGTCGAGCTC
GCGGTGCGCGCGGGCGACGAGGCCGGCTGCGACCGGCTCACCGAACTCGCCCTGGAGACC
CCGATGGTGATCCCCGCCGAGGGCGCCGTCCAGGTGCAGGTGGTGGTCGGTCCGGAGAGC
GACACGGGACGCGCCGTCACCGTCTACGGGCGGCCCGAGAGCGCCGGGGACGCGGGCGAG
TGGACCCGGCACGCCCACGGCCGCCTGGAGCGCTCGGACAGCCCCGAGGGCGGCACCGAA
CTCACCGCCTGGCCGCCGAGCGGCGCCGAGCGGGTCGACCTCGACGGCTTCTATGAGGGG
CTGCACCAGCAGGGGTACGGGTACGGCCCGGTCTTTCAGGGGTTGGCCGACGTCTGGCTC
GCGGGCGACGGTGGCGGTGTGTTCGCCGAGGTGACGCTGCCAGCGGAGCAGCAGGAAGAC
GCAGGCCGGTTCGGCCTCCACCCGGCCCTGCTCGACTCGGCGCTCCACGCGCTCGCGGTC
AGCGGGCCGGAGGCGGAGGAGGGCACGGCCTGGCTGCCGTACGCCTTCACGGGGCTGCGC
CTGTACGCGGCCGGTGCCACCCGGGTGCGCGTCCACCTCAAGCCGGTCGGCCCCGAGGAA
GTGGCCCTCGTGGTCGCCGATGTGACCGGGCGTCCGGTCGCCACCGTCGACTCCTTCGCC
TCCCGGCTGGTCTCCGGCGCCGAGCTGAGGGCCCTCGCGGACGCGGTTGCCGGAGGCACC
GCCGCGGCCGTCCTGCCGGGAGCCCCGCTGCGCCGCGCGGCGGCCGGGCAGGACGACGCC
GAGGCCGAGTCCTTCACCGCCCGGCTCGCCGCGATGGGCCCCGAGGAGCAGGAGCGCGCG
CTGACCGACCTGGTGCGCAGCCGGGTCGCCGCGGTGCTCGGGCACGGCGAGAGCGAGACC
GTGGAGGCCGAACGCGCCTTCCGCGACCTCGGCTTCGACTCGCTCACCGCGGTCGAGCTG
CGCAACCGGCTCACCGCCGCCACCGGCCTGAGCCTGCCCGCGACGCTGGTCTTCAGCCAC
CCCACCCCGCTGGCCCTCGCCCGGCACCTGCTCGACCAGCTCGGCACCGCGGGCGCCGCG
GAGGGCCCGGTGGCCCGCGAGTTCGCCGCCCTCGAAGCGGCCCTGTCGGCCGAGGCCCCC
GAGGGCGAGGACCGCGAGGCGGTCGTCGGCCGCCTGGAGGCCCTGCTGTGGCGGTGGCGG
GAGCGCTCCGGCTCCGGTTCCGGGGGTGTGATCGAGTCCGGCGCCCTCGACTCGGTGTCC
GACGACGAGATCTTCGACCTGATCGACAAGGAACTGGGAGCTTCCTGA
[10] KS38..414
[10] AT585..904
[10] methylmalonyl-CoA776..780
[10] DH952..1115
[10] ACP1281..1351
[10] KS112..1242
[10] AT1753..2712
[10] methylmalonyl-CoA2326..2340
[10] DH2854..3345
[10] ACP3841..4053

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [775-892]  3.4e-69 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR006162 Phosphopantetheine attachment site (PTM)
 [1309-1324]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1281-1351]  21.233 PS50075
PS50075   ACP_DOMAIN
 [1284-1350]  1.1e-12 PF00550
PF00550   PP-binding
 [1273-1368]  1.7e-23 SSF47336
SSF47336   ACP-like
 [1279-1355]  1.7e-21 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [38-288]  3.3e-91 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [296-414]  9.5e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [585-904]  7.1e-105 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [6-30]  6e-12 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [583-885]  1.2e-64 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [710-775]  2.4e-17 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [38-298]  7.8e-89 G3DSA:3.40.47.10 [300-466]  1e-62 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [30-412]  1.4e-100 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [201-217]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [587-884]  1.9e-109 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1282-1354]  3.6e-34 SM00823
SM00823   Phosphopantetheine attachment site
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [952-1115]  1.2e-79 SM00826
SM00826   no description
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [40-466]  3.4e-218 SM00825
SM00825   Beta-ketoacyl synthase
SignalP No significant hit
TMHMM No significant hit