close all open/close all

CDS information : Salino_00980


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction163,486 / 174,660 / + [in whole cluster]
163,486 / 174,660 / + [in contig]
Location163486..174660 [in whole cluster]
163486..174660 [in contig]
TypeCDS
Length11,175 bp (3,724 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I modular polyketide synthase
Gene
Gene (GenBank)salAVIII
EC number
Keyword
Note
Note (GenBank)
  • Polyketide synthase domains: KS, AT, KR, ACP, KS,AT, KR, EH, DH, ACP
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Related Reference
ACC
H6D576
NITE
Salino3_00200
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)

close this sectionPKS/NRPS Module

12 methylmalonyl-CoA
13 malonyl-CoA
KS34..409
AT571..889
KR1194..1373
ACP1479..1549
KS1572..1947
AT2103..2422
DH2470..2632
ER2968..3273
KR3283..3463
ACP3568..3638

close this sectionSequence

selected fasta
>polyketide synthase [type I modular polyketide synthase]
MSNTNEDKLREYLKRATTDLRNARRRVRELEEPEPVAVVRMACRFPGEVASPEELWDLVA
EGREGISGFPEDRGWDLEALYDPDPDRAGTSYTQRGGFLQEVPQFDAQLFGISPREALAM
DPQQRLLLETAWEVLERAGIDPHSLKGSSTGVFVGASSSSYGGDLEEVPEGVEGYLGTGS
AAAVVSGRLAYTFGLEGPAVTVDTACSSSLVALHLAVQALRQNECGLALAAGVTVMSTPG
LFVEFSRQRGLASDGRCKAFGDTADGTGFAEGVGVLLLERLSDARRNGHEVLAVIRGSAV
NQDGASNGLTAPNGPSQRRVIKQALANARLEAAEIDAVEAHGTGTTLGDPIEAQALIATY
GKGRAPERPLWLGSVKSNIGHTQAAAGMAGVMKMIMAMRHGVLPRTLHADSPSTKIDWSA
GTVRLLQEDTPWERREDAPRRAGVSAFGVGGTNAHVILEQDTPAEPAPEAPAAEPAPRVL
DTRLLPWLVSGKNPGALRAQADRLHGFATASEAAPADIALSLATTRAALEQRGAVVAADR
AALASGLTALADGTSSPAVVQGTTLPGAGVVFVFPGQGSQWPGMAVELLDSSPVFAARLR
ECAEALAPYVDWSLLDVLRQADGAPGFDRVDVVQPALWAVMVSLAELWRASGVRPAAVIG
HSQGEIAAAAVSGALSLGDAAKVSALRAKALLALAGKGGMVSVAAPAAEVTTRIAAWGER
LAVASVNGPQSTVVSGEPGALDELLAACERDGVRARRINVDYASHGPQVETIREQVLTAL
DGIRPGRTGVPFLSTVTGEFVTGTELDAAYWYTNLRNTVRFEDAVRTLLAEGHGLFIEAS
AHPVLTVGVQETLDDAGQPAATLGSLRREEGGPGRFLTSLAEAWTRGAPVDWPRLLGGPG
TRTVELPTYAFQQERYWLESDPAAESAGGLPADEIEARFWDAVEREDLEELAGTLDVDED
GDHGLSRLLPALASWRRRRREGAEIDRWRYRVEFTRLGDPGQARLDGTWLLVVPEGADTL
AASCAGALERHGADTLTLPAATADRTALAETLGALAGTPLAGVLSLTGLAAEDPALLTLT
LAQALADAGLTAPLWCATRGAVSAVRGDAPATPAQAQVWGLGRVLALEAPRTWGGLIDLP
AAPDERALTRFVQALAASGEEDQIAVRDTGLYGRRLVRARLADRESGHEWRPRGTVLITG
GTGGVGAHAARRLASLGAPHLLLTSRRGPQAPGAAELIRELGELGARATVVACDAADREA
LAAALASVPEDAPLTAVLHAAGVPQSTPFDALTPEEFAEVTAGKVRGAEHLDALLGDTPL
DAFVLFSSNSGVWGAAGHTAYAAANAHLDALAEQRRARGLRATSLAWGAWGGGGIMDTEG
ARAYMAKRGVLEMEPATALTALLRAVDHEETFLAVADVDWARFAPGFTSGRPSPLLDGVP
EAREALRAAQPGEGQEGTYASEFAERLAGATEAEREEITLDLVRTEAAAVLGHTTLDAVA
PDRAFKDFGFDSLTAVDLRNRLTTATGLTLPATLVFDHPTPTALARFVRAEVLGTPDRSA
ERAGTSNTATDEPLAIVAMSCRYPGGVLSPEDLWQLVAEGRDAISGFPTDRGWDLGSLYD
PDPDALGTSYVREGGFVDSATRFDPGFFGISPREALTMDPQQRLLLETSWETFERAGIDP
ETLKGSSTGVFIGAGYPGYGEGMEMPEGSEGHMLFGASAAVVSGRVAYTFGLEGPAVTVD
TMCSSSLVALHLAAQALRSGECSMALAGGAMVMCSPGVFIGFSQQRGLSPDGRCKSFAEE
ADGTGWSEGVGVLLLERLSDAERNGHQVLAVIRGSATNQDGASNGLTAPNGPAQQRVIRQ
ALANAGLTGDQVDVVEAHGTGTTLGDPIEAQALLATYGQDHSAQSPLLLGSVKSNMGHAQ
AASGVAGVIKMVMAMRHGIVPRTLHIDNPSTEVDWNSGAVELLAESRDWPETGRPRRAAV
SSFGGSGTNAHLVLEQAPAPAPAEPRPAAEAPRLPLPWLLSGRGTPGLRAQAARLRDFFA
ADGTLDATDLAYSLTTTRAALETRGAVLAEDREGLLTALTALAEGSPAPGVVSGTAKPAK
TAFLFSGQGSQRPGAGRQLHAAFPVFAEALDELCAEFDRHLDRPLRTLLFAEEGTEDAAL
LDATRYTQPALFTLEVALFRQLAALGVRPGVLVGHSIGEIAAAHAAGVLSLADACALVAA
RGRLMQELPAGGVMISLRATEEEVLPLLAEVADRVSVAAVNGPASVVISGEAEAAREVAA
RLAEQGRKTRELTVSHAFHSPLMEPMLAEFRRVAEQLTYQAPTLPVVSNLTGEQLTEFGA
DYWVRHVREAVRFADGVRTVFGLGANTLIELGPGGVLTAMAQECVEDGGPAPLLVPALRK
DRPEPEAFLGALAQAWAHGVDVDWSGLYEGRAARRVDLPTYAFQHERFWPEPRTAGAADA
SGLGLTDAGHPLLGAATELADGAGLLFTGRLSPETQPWLADHAVAGTVILPGTAFVELAV
RAGDEAGTGRLEELTLEAPLPLPERGGVQIQVRVGEADSAGRRPVAVHSRPENAAGRPWT
RHASGELAPAAGESAPGLGAWPPPGAEALDVGGFYAGAAEVGYGFGPSFQGLTAAWKHPE
SGEVFAEVVLPEPQQAQAGKYVLHPALLDAALHGMRLGDFVEQTGEARLPFLFNGVHLHA
AGASALRVRIAKAGTDTIAVTATDTAGHPVATLDSLVLRPVATASLQQSAGEAEGLFRLD
WVPVPAPTTAAAGTWAVLGADTPGLADTLRTAGAAASYPDVAAMKAALTAGDPLPDTVLL
PLGPQTGAQEAGADAVRESTARLLGHLKDWFADTSLEDVRLAVLTRGAVATRTGEDVTDL
AHAPAWGLVRSAQTENPGRLVLLDLDPKAEAPAAALPGALAATAEADEPGAALRGETLLV
PRLVTTAGSGSLTLPEEAAWTLDTRARGTLDNLGLLPRPEAEAPLAENTVRIAVHAAGLN
FRDVMIALGMYPGEAFLGSEAAGVVTETGPGVTSLAVGDRVMGMIPHAFGPLAVADHRMV
ARIPAGWTFERAASVPAAFLTAAYALRDLADLKRGEKVLVHAAAGGVGMAAVQLAQHLGA
EVFATASKGKWDALRAAGLDEAHIASSRDADFEEYFSASSDGKGMDVVLDSLSGELVDAS
LRLLAKGGRFIEMGKTDIRDPEQIARDHGGALYRAFDLAEAGPERTGEMLAELAALFDSG
ALTPLPVRSWDIRRAPEAFRLMSRAQHIGKIVLTVPQRWDPEGTVLITGGTGTLGALLAR
HLVTAHGVRHLVLAGRRGPEAPGAAELVAEIAELGGTAQVVACDAADRERLAAVLAEIPA
ERPLRAVVHTAGIVDDGVLGSLDAERLAAVLRPKADAALNLHELTRDLELTDFVLYSSAA
GVSGNSGQANYAAANAFLDALAHHRRAQGLPARSLAWGMWEPAGGMTADLAETDVARMTR
GGVTPLTPETGLALFDAAARLDEALYVPVRLDPASLGGQSGGAVPALYRALVRTPVRRSA
QAAAAASEPEELLGRLAGRTAAQAAEILLDLVRTHVCAVLGITDPRTVEADRAFKDIGFD
SLTAVELRNRLNSATGLRLPATLIFDFPSPGELVDHLRTELAPEAAGAQDTGTGSEEADE
QQIRRVLSSVPVRRLREAGLLDALLELGAAPVGETAAQQPQQAAAIAEMDVDALVSLALD
NSNS
selected fasta
>polyketide synthase [type I modular polyketide synthase]
TTGAGCAACACCAATGAAGACAAGCTCCGCGAATATCTGAAGCGGGCCACCACCGACCTG
CGCAACGCGCGCAGGCGGGTACGGGAGCTGGAAGAGCCGGAGCCGGTCGCCGTGGTGCGC
ATGGCCTGCCGCTTCCCCGGCGAGGTCGCGAGCCCGGAAGAGCTGTGGGACCTGGTCGCC
GAGGGCCGGGAGGGCATCTCCGGCTTCCCCGAGGACCGCGGCTGGGACCTGGAGGCGCTG
TACGACCCGGACCCGGACCGGGCCGGGACCTCGTACACCCAGCGGGGCGGATTCCTTCAG
GAGGTCCCGCAGTTCGACGCCCAGCTCTTCGGGATCTCGCCGCGTGAGGCGCTGGCCATG
GATCCGCAGCAGCGGCTGCTCCTGGAGACCGCCTGGGAGGTCCTGGAGCGGGCCGGTATC
GACCCGCACTCGCTGAAGGGCAGCAGCACCGGCGTCTTCGTCGGCGCCTCCTCCTCCAGC
TACGGCGGCGACCTGGAGGAGGTCCCGGAGGGCGTCGAGGGCTACCTCGGCACCGGCAGC
GCGGCGGCCGTGGTCTCCGGCCGCCTCGCCTACACCTTCGGCCTCGAAGGCCCCGCGGTC
ACCGTCGACACCGCCTGCTCCTCCTCGCTCGTGGCCCTGCACCTCGCGGTGCAGGCGCTG
CGGCAGAACGAGTGCGGGCTCGCCCTGGCCGCGGGCGTCACCGTGATGTCCACGCCGGGG
CTCTTCGTCGAGTTCAGCCGCCAGCGCGGGCTCGCCTCCGACGGCCGCTGCAAGGCCTTC
GGGGACACCGCGGACGGCACCGGCTTCGCGGAGGGCGTCGGCGTGCTCCTCCTGGAGCGG
CTCTCCGACGCCCGCCGCAACGGGCACGAGGTCCTGGCCGTGATCCGCGGCTCCGCCGTC
AACCAGGACGGCGCGAGCAACGGCCTCACCGCGCCCAACGGCCCCTCCCAGCGCCGCGTC
ATCAAGCAGGCGCTCGCCAACGCCCGCCTGGAGGCCGCCGAGATCGACGCGGTCGAGGCG
CACGGCACCGGCACCACCCTCGGCGACCCCATCGAGGCCCAGGCCCTCATCGCCACCTAC
GGCAAGGGCCGCGCGCCCGAACGCCCGCTCTGGCTCGGCTCGGTGAAGTCGAACATCGGC
CACACCCAGGCCGCCGCGGGCATGGCCGGCGTGATGAAGATGATCATGGCCATGCGCCAC
GGCGTCCTGCCCAGGACCCTGCACGCCGACAGCCCCAGCACCAAGATCGACTGGTCCGCG
GGCACCGTCCGGCTGCTCCAGGAGGACACCCCCTGGGAGCGGCGCGAGGACGCCCCCCGC
CGCGCGGGCGTCTCCGCCTTCGGCGTCGGCGGCACCAACGCCCACGTCATCCTCGAACAG
GACACCCCCGCCGAGCCCGCCCCCGAGGCCCCGGCCGCCGAGCCCGCCCCGCGCGTCCTG
GACACCCGGCTGCTTCCCTGGCTGGTCTCCGGCAAGAACCCCGGCGCCCTGCGCGCCCAG
GCCGACCGGCTGCACGGCTTCGCCACCGCCTCCGAGGCCGCGCCCGCCGACATCGCGCTC
TCGCTGGCCACCACCCGTGCCGCCCTGGAGCAGCGCGGCGCCGTGGTCGCCGCGGACCGT
GCCGCCCTCGCCTCCGGCCTGACCGCCCTCGCCGACGGCACCTCCAGCCCGGCCGTGGTC
CAGGGCACCACCCTGCCCGGCGCCGGAGTCGTCTTCGTCTTCCCCGGTCAGGGTTCGCAG
TGGCCGGGTATGGCGGTCGAACTCCTGGACTCCTCGCCGGTGTTCGCGGCGCGGTTGCGG
GAGTGCGCCGAGGCGCTGGCCCCGTACGTGGACTGGTCGCTGCTGGATGTGCTGCGGCAG
GCGGACGGCGCCCCGGGCTTCGACCGGGTGGATGTCGTGCAGCCCGCGCTGTGGGCCGTG
ATGGTCTCGCTCGCCGAACTCTGGCGCGCCTCGGGGGTGCGCCCCGCCGCGGTCATCGGC
CACTCGCAGGGCGAGATCGCCGCCGCGGCCGTCTCCGGTGCGCTGTCGCTCGGCGACGCC
GCGAAGGTCTCGGCGCTGCGGGCCAAGGCGCTGCTCGCGCTCGCGGGCAAGGGCGGCATG
GTCTCGGTCGCGGCCCCCGCCGCCGAGGTCACCACCCGTATCGCGGCCTGGGGCGAACGC
CTCGCCGTCGCCTCCGTGAACGGCCCGCAGTCCACCGTGGTCTCCGGCGAACCGGGCGCC
CTGGACGAACTCCTCGCCGCCTGCGAGCGGGACGGGGTGCGCGCCCGCCGCATCAACGTC
GACTACGCCTCGCACGGCCCCCAGGTCGAGACCATCCGCGAGCAGGTCCTCACCGCCCTC
GACGGGATCCGGCCGGGCCGCACCGGGGTGCCCTTCCTCTCCACCGTCACCGGCGAGTTC
GTCACCGGCACCGAGCTGGACGCCGCGTACTGGTACACCAACCTGCGCAACACCGTCCGC
TTCGAGGACGCCGTACGCACCCTGCTCGCCGAGGGCCACGGGCTCTTCATCGAGGCGAGC
GCGCACCCGGTGCTGACCGTCGGCGTGCAGGAGACCCTCGACGACGCCGGGCAGCCCGCC
GCGACCCTCGGCAGCCTGCGCCGCGAGGAGGGCGGCCCCGGGCGCTTCCTCACCTCGCTC
GCCGAGGCCTGGACCCGCGGCGCCCCCGTCGACTGGCCGCGCCTCCTCGGCGGCCCCGGC
ACCCGTACCGTCGAACTCCCCACCTACGCCTTCCAGCAGGAGCGCTACTGGCTGGAGTCC
GACCCCGCCGCCGAGAGCGCGGGCGGGCTGCCCGCCGACGAGATCGAGGCCCGCTTCTGG
GACGCCGTCGAGCGCGAGGACCTGGAGGAACTCGCCGGGACCCTGGACGTCGACGAGGAC
GGCGACCACGGCCTGAGCAGGCTGCTTCCCGCCCTCGCCTCCTGGCGCCGGCGCCGCCGC
GAGGGCGCCGAGATCGACCGCTGGCGCTACCGCGTCGAGTTCACCCGGCTCGGCGACCCG
GGGCAGGCCCGGCTCGACGGCACCTGGCTGCTCGTCGTCCCCGAGGGCGCGGACACCCTC
GCCGCCTCCTGCGCCGGGGCCCTGGAGCGGCACGGCGCCGACACCCTGACGCTGCCCGCC
GCGACCGCCGACCGCACCGCCCTCGCCGAGACCCTCGGCGCCCTGGCCGGCACCCCCCTC
GCGGGCGTGCTCTCCCTCACCGGCCTGGCCGCCGAGGACCCGGCCCTGCTCACCCTCACC
CTGGCCCAGGCCCTCGCCGACGCGGGACTCACCGCCCCGCTGTGGTGCGCCACCCGGGGC
GCCGTCTCCGCCGTCCGCGGCGACGCGCCCGCCACCCCCGCCCAGGCCCAGGTCTGGGGC
CTCGGCCGCGTCCTCGCCCTGGAGGCGCCCCGTACCTGGGGCGGCCTGATCGACCTGCCC
GCCGCACCCGACGAGCGGGCCCTCACCCGCTTCGTCCAGGCCCTCGCCGCGAGCGGCGAG
GAGGACCAGATCGCGGTACGCGACACCGGGCTCTACGGACGCAGGCTGGTCCGCGCCCGG
CTCGCCGACCGCGAGAGCGGCCACGAATGGCGGCCGCGCGGCACCGTCCTGATCACCGGC
GGCACCGGGGGAGTGGGCGCCCACGCCGCCCGTAGGCTCGCCTCGCTCGGCGCCCCCCAC
CTGCTGCTCACCAGCCGCCGCGGCCCCCAGGCGCCCGGCGCCGCCGAACTCATCCGCGAA
CTCGGCGAGTTGGGCGCCCGCGCCACGGTCGTCGCCTGCGACGCCGCCGACCGCGAGGCG
CTGGCCGCCGCGCTGGCCTCGGTGCCCGAGGACGCCCCGCTGACCGCCGTCCTGCACGCC
GCGGGCGTCCCCCAGTCCACCCCCTTCGACGCGCTCACCCCCGAGGAGTTCGCCGAGGTC
ACCGCGGGCAAGGTGCGCGGCGCCGAGCACCTCGACGCCCTGCTCGGGGACACCCCGCTC
GACGCCTTCGTGCTCTTCTCCTCCAACTCCGGGGTCTGGGGCGCCGCGGGCCACACCGCC
TACGCCGCCGCCAATGCCCACCTCGACGCCCTCGCCGAGCAGCGCCGCGCCCGCGGACTG
CGGGCCACCTCGCTGGCCTGGGGCGCCTGGGGCGGCGGCGGGATCATGGACACCGAGGGC
GCCCGCGCCTACATGGCCAAGCGCGGCGTCCTGGAGATGGAGCCCGCGACCGCGCTCACC
GCCCTGCTGCGCGCCGTCGACCACGAGGAGACCTTCCTCGCTGTCGCCGACGTCGACTGG
GCCCGCTTCGCCCCCGGCTTCACCTCCGGCCGCCCGAGCCCCCTGCTCGACGGCGTCCCC
GAGGCCCGCGAGGCACTGCGCGCCGCACAGCCCGGTGAGGGCCAGGAGGGCACCTACGCC
TCCGAGTTCGCCGAGCGCCTGGCCGGTGCCACCGAGGCCGAGCGCGAGGAGATCACCCTG
GACCTGGTGCGCACCGAGGCCGCCGCGGTCCTCGGGCACACCACCCTGGACGCCGTCGCC
CCCGACCGCGCCTTCAAGGACTTCGGCTTCGACTCGCTGACCGCCGTCGACCTGCGCAAC
CGCCTGACCACGGCCACCGGTCTCACCCTCCCCGCCACCCTGGTCTTCGACCACCCCACC
CCGACGGCGCTGGCCCGCTTCGTCCGCGCCGAGGTCCTCGGCACCCCCGACCGGTCCGCC
GAGCGGGCCGGGACCTCCAACACCGCCACCGACGAACCCCTCGCCATCGTCGCCATGAGC
TGCCGCTACCCGGGCGGGGTGCTCTCGCCCGAGGACCTGTGGCAGCTGGTCGCCGAGGGC
CGCGACGCCATCTCCGGCTTCCCCACCGACCGCGGCTGGGACCTGGGCTCGCTCTACGAC
CCGGACCCGGACGCGCTCGGCACCAGCTATGTGCGCGAGGGCGGATTCGTCGACAGCGCC
ACCCGTTTCGACCCCGGCTTCTTCGGGATCTCGCCGCGCGAGGCGCTCACCATGGACCCG
CAGCAGCGGCTCCTCCTGGAGACCTCCTGGGAGACCTTCGAGCGCGCCGGGATCGACCCG
GAGACCCTCAAGGGCAGCAGCACCGGCGTGTTCATCGGCGCCGGATACCCCGGCTACGGC
GAGGGCATGGAGATGCCCGAGGGCTCCGAGGGGCACATGCTCTTCGGCGCCTCCGCCGCC
GTCGTCTCCGGCCGTGTCGCCTACACCTTCGGCCTCGAAGGGCCCGCGGTCACCGTCGAC
ACCATGTGCTCCTCCTCCCTGGTCGCCCTGCACCTCGCCGCGCAGGCGCTGCGCAGCGGG
GAGTGCTCGATGGCGCTGGCGGGCGGCGCGATGGTGATGTGCTCGCCCGGCGTCTTCATC
GGCTTCAGCCAGCAGCGCGGACTCTCCCCGGACGGCCGCTGCAAGTCCTTCGCCGAGGAG
GCGGACGGCACCGGCTGGTCCGAGGGCGTCGGCGTGCTGCTCCTGGAACGCCTCTCGGAC
GCCGAGCGCAACGGCCACCAGGTTCTCGCCGTCATCCGCGGCTCCGCCACCAACCAGGAC
GGCGCCTCCAACGGGCTGACCGCCCCCAACGGCCCCGCCCAGCAGCGCGTCATCCGCCAG
GCCCTCGCCAACGCCGGCCTCACCGGCGACCAGGTCGACGTGGTCGAGGCGCACGGCACC
GGCACCACCCTCGGCGACCCCATCGAGGCGCAGGCGCTGCTCGCCACCTACGGGCAGGAC
CACAGCGCGCAGAGCCCGCTGCTGCTCGGCTCGGTGAAGTCCAACATGGGCCACGCGCAG
GCCGCTTCGGGCGTCGCGGGCGTCATCAAGATGGTGATGGCGATGCGGCACGGCATCGTC
CCGCGCACCCTGCACATCGACAACCCCAGCACCGAGGTCGACTGGAACTCCGGGGCGGTG
GAACTCCTCGCCGAGTCCCGCGACTGGCCCGAGACCGGCCGCCCCCGCCGCGCCGCCGTC
TCCTCCTTCGGCGGCAGCGGCACCAACGCCCACCTCGTCCTGGAGCAGGCCCCCGCACCG
GCGCCCGCCGAGCCCCGGCCCGCGGCCGAGGCACCCCGGCTGCCGCTGCCCTGGCTGCTC
TCCGGCCGCGGCACCCCGGGACTGCGCGCCCAGGCCGCCCGCCTGCGCGACTTCTTCGCC
GCCGACGGGACCCTGGACGCCACCGACCTCGCGTACTCGCTCACCACCACCCGCGCGGCC
CTGGAGACCCGCGGCGCGGTGCTCGCCGAGGACCGCGAGGGCCTGCTCACCGCGCTGACC
GCGCTCGCCGAGGGCAGCCCCGCACCGGGCGTCGTCTCCGGCACCGCCAAGCCCGCGAAG
ACCGCCTTCCTCTTCTCCGGGCAGGGCAGCCAGCGTCCCGGCGCGGGCCGCCAACTGCAC
GCCGCCTTCCCGGTGTTCGCCGAGGCCCTCGACGAACTCTGCGCGGAGTTCGACCGCCAC
CTCGACCGTCCGCTGCGCACCCTCCTCTTCGCCGAGGAGGGCACCGAGGACGCCGCGCTC
CTGGACGCCACCCGCTACACCCAGCCCGCGCTCTTCACCCTCGAAGTGGCCCTCTTCCGC
CAGCTGGCCGCCCTCGGCGTACGGCCCGGCGTCCTGGTCGGCCACTCCATCGGCGAGATC
GCGGCCGCCCATGCCGCCGGGGTGCTCTCCCTGGCCGACGCCTGCGCCCTGGTCGCCGCC
CGCGGCCGCCTGATGCAGGAACTCCCGGCGGGCGGCGTGATGATCTCGCTGCGCGCCACG
GAGGAGGAGGTCCTGCCGCTGCTCGCCGAGGTGGCGGACCGCGTCTCGGTCGCCGCCGTC
AACGGGCCCGCTTCGGTGGTGATCTCCGGCGAGGCCGAGGCCGCCCGGGAGGTCGCCGCC
CGGCTCGCCGAGCAGGGCCGCAAGACCCGCGAACTGACCGTCTCGCATGCCTTCCACTCG
CCGCTCATGGAGCCGATGCTCGCCGAATTCCGGCGCGTGGCCGAGCAGTTGACCTACCAG
GCGCCCACCCTGCCGGTGGTCTCCAACCTCACCGGCGAGCAGCTCACCGAGTTCGGCGCC
GACTACTGGGTCCGGCACGTACGCGAGGCGGTCCGCTTCGCCGACGGCGTCCGCACCGTC
TTCGGGCTCGGCGCCAACACCCTGATCGAGCTGGGCCCCGGCGGCGTGCTCACCGCCATG
GCCCAGGAGTGCGTCGAGGACGGCGGCCCCGCCCCGCTGCTCGTGCCCGCCCTGCGCAAG
GACCGCCCCGAGCCCGAGGCCTTCCTCGGCGCCCTCGCCCAGGCCTGGGCGCACGGCGTC
GACGTCGACTGGAGCGGACTGTACGAGGGCCGCGCGGCCCGCCGCGTCGACCTGCCCACC
TACGCCTTCCAGCACGAGCGCTTCTGGCCCGAGCCGCGCACCGCGGGCGCCGCCGACGCG
AGCGGTCTCGGACTCACCGACGCCGGGCACCCCCTGCTCGGCGCCGCCACCGAACTCGCC
GACGGCGCGGGCCTGTTGTTCACCGGCAGGCTCTCCCCGGAGACCCAGCCCTGGCTCGCC
GACCACGCGGTCGCCGGCACCGTCATCCTGCCCGGCACCGCCTTCGTCGAGCTCGCCGTA
CGGGCCGGTGACGAGGCGGGGACCGGCCGCCTGGAGGAACTCACCCTGGAGGCCCCGCTG
CCGCTGCCCGAGCGCGGCGGCGTCCAGATCCAGGTGCGCGTCGGCGAGGCCGACAGCGCG
GGCCGCCGCCCGGTGGCCGTCCACTCCCGGCCGGAGAACGCCGCCGGACGCCCCTGGACC
CGGCACGCCAGCGGTGAACTCGCCCCCGCCGCAGGGGAGTCGGCCCCCGGACTCGGCGCC
TGGCCGCCGCCCGGCGCCGAGGCCCTCGACGTCGGCGGCTTCTACGCCGGTGCCGCCGAG
GTCGGCTACGGCTTCGGCCCCTCCTTCCAGGGCCTGACCGCGGCCTGGAAGCACCCGGAG
AGCGGCGAGGTCTTCGCCGAGGTCGTGCTGCCCGAACCGCAGCAGGCCCAGGCGGGCAAG
TACGTACTGCACCCCGCCCTGCTCGACGCCGCCCTGCACGGCATGCGCCTCGGCGACTTC
GTCGAGCAGACCGGCGAGGCACGGCTGCCCTTCCTCTTCAACGGGGTCCACCTGCACGCC
GCGGGCGCCTCGGCGCTGCGGGTGCGCATCGCCAAGGCCGGTACGGACACCATCGCGGTG
ACCGCCACCGACACCGCGGGCCACCCCGTCGCCACCCTCGACTCCCTGGTCCTGCGCCCG
GTCGCCACCGCCTCGCTCCAGCAGTCCGCGGGCGAGGCCGAGGGCCTGTTCCGCCTCGAC
TGGGTCCCCGTACCGGCGCCCACCACGGCCGCCGCGGGCACCTGGGCGGTCCTCGGCGCC
GACACCCCCGGCCTCGCGGACACCCTGCGCACCGCGGGCGCGGCCGCCTCGTACCCCGAT
GTCGCCGCCATGAAGGCCGCGCTCACCGCGGGCGACCCGCTGCCGGACACCGTGCTCCTC
CCGCTCGGCCCGCAGACCGGGGCCCAGGAGGCCGGTGCGGACGCCGTACGGGAGTCCACC
GCCCGCCTCCTCGGCCACCTCAAGGACTGGTTCGCCGACACCTCCCTGGAGGACGTCCGG
CTCGCGGTCCTCACCCGCGGCGCCGTCGCCACCCGCACCGGCGAGGACGTCACCGACCTC
GCGCACGCCCCCGCCTGGGGCCTGGTCCGCTCCGCGCAGACCGAGAACCCCGGCCGCCTG
GTCCTGCTCGACCTCGACCCAAAGGCCGAGGCGCCCGCCGCCGCGCTGCCCGGTGCCCTC
GCCGCGACCGCCGAGGCGGACGAGCCCGGGGCCGCATTGCGCGGCGAGACGCTGCTCGTC
CCGCGCCTGGTGACCACCGCCGGATCGGGCTCCCTGACGCTGCCCGAGGAGGCCGCCTGG
ACCCTGGACACCCGGGCCCGCGGCACCCTGGACAACCTCGGCCTGCTGCCCCGCCCGGAG
GCGGAGGCACCGCTCGCCGAGAACACCGTACGGATCGCCGTGCACGCCGCCGGACTCAAC
TTCCGCGATGTGATGATCGCCCTCGGCATGTACCCGGGGGAGGCCTTCCTCGGCAGCGAG
GCCGCGGGCGTGGTCACCGAGACCGGCCCCGGCGTCACCTCGCTCGCCGTCGGCGACCGC
GTCATGGGCATGATCCCGCACGCCTTCGGGCCGCTCGCCGTCGCCGACCACCGCATGGTC
GCCCGGATCCCGGCGGGCTGGACCTTCGAGCGCGCCGCCTCGGTACCGGCCGCCTTCCTC
ACCGCCGCCTACGCGCTGCGCGACCTCGCGGACCTCAAGCGGGGCGAGAAGGTGCTCGTC
CACGCCGCCGCGGGCGGTGTCGGCATGGCCGCCGTGCAGCTCGCCCAGCACCTCGGCGCC
GAGGTCTTCGCCACCGCCAGCAAGGGCAAGTGGGACGCGCTGCGCGCCGCCGGACTCGAC
GAGGCGCACATCGCCTCCTCCCGCGACGCCGACTTCGAGGAGTACTTCTCCGCCTCCTCC
GACGGCAAGGGCATGGACGTCGTCCTCGACTCGCTCAGCGGCGAACTCGTCGACGCCTCG
CTGCGCCTGCTGGCCAAGGGCGGCCGCTTCATCGAGATGGGCAAGACCGACATCCGCGAC
CCGGAGCAGATCGCACGCGACCACGGCGGCGCCCTCTACCGGGCCTTCGACCTCGCCGAG
GCCGGACCCGAGCGCACCGGCGAGATGCTCGCCGAACTCGCCGCGCTCTTCGACTCCGGA
GCCCTCACCCCGCTGCCGGTCCGCAGCTGGGACATCCGGCGCGCCCCCGAGGCCTTCCGC
CTGATGAGCCGCGCCCAGCACATCGGCAAGATCGTGCTCACCGTCCCGCAGCGCTGGGAC
CCCGAGGGCACCGTCCTGATCACCGGCGGCACCGGCACCCTCGGCGCCCTGCTCGCCCGC
CACCTGGTCACCGCACACGGCGTACGCCACCTGGTGCTCGCCGGGCGGCGCGGACCCGAG
GCCCCCGGCGCGGCCGAACTGGTCGCCGAGATCGCCGAGTTGGGCGGTACGGCCCAGGTC
GTCGCCTGCGACGCGGCGGACCGGGAGCGGCTGGCCGCGGTGCTGGCCGAGATCCCCGCC
GAGCGCCCGCTGCGCGCCGTCGTGCACACCGCGGGCATCGTCGACGACGGCGTCCTCGGC
TCCCTGGACGCCGAACGCCTCGCCGCCGTACTGCGGCCCAAGGCGGACGCCGCCCTCAAC
CTGCACGAGCTGACCCGCGACCTGGAGCTGACCGACTTCGTCCTCTACTCCTCCGCCGCG
GGCGTCTCCGGCAACTCCGGCCAGGCCAACTACGCCGCCGCCAACGCCTTCCTGGACGCC
CTGGCCCACCACCGCCGCGCCCAGGGGCTGCCCGCCCGCTCGCTGGCCTGGGGCATGTGG
GAACCGGCGGGCGGCATGACCGCCGACCTCGCCGAGACCGACGTGGCGCGGATGACCCGC
GGCGGCGTCACCCCGCTCACCCCGGAGACCGGCCTCGCCCTCTTCGACGCCGCCGCCCGG
CTCGACGAGGCCCTGTACGTGCCCGTACGGCTCGACCCGGCCTCGCTCGGCGGACAGAGC
GGCGGCGCGGTACCCGCGCTCTACCGGGCCCTGGTCCGCACCCCGGTGCGGCGCAGCGCC
CAGGCCGCCGCCGCGGCCTCCGAGCCCGAGGAACTGCTCGGCCGCCTCGCCGGGCGCACC
GCCGCCCAGGCCGCCGAGATCCTCCTCGATCTGGTCCGCACCCACGTCTGCGCGGTGCTC
GGCATCACCGACCCCCGTACCGTCGAGGCCGACCGCGCCTTCAAGGACATCGGCTTCGAC
TCGCTGACCGCGGTCGAACTGCGCAACCGCCTGAACAGCGCCACCGGGCTCCGGCTGCCC
GCCACCCTGATCTTCGACTTCCCCTCCCCGGGCGAACTCGTCGACCATCTGCGCACCGAA
CTGGCCCCCGAGGCCGCCGGCGCCCAGGACACCGGCACCGGCTCCGAGGAGGCCGACGAG
CAGCAGATCCGGCGCGTCCTGTCGAGCGTTCCGGTGCGGCGGCTGCGGGAGGCCGGACTC
CTCGACGCGCTCCTCGAGCTCGGCGCCGCCCCGGTCGGCGAGACGGCCGCGCAGCAACCG
CAGCAGGCCGCGGCGATCGCCGAGATGGACGTCGACGCCCTCGTCTCGCTGGCCCTCGAC
AACAGCAACTCCTGA
[12] KS34..409
[12] AT571..889
[12] methylmalonyl-CoA762..766
[12] KR1194..1373
[12] ACP1479..1549
[13] KS1572..1947
[13] AT2103..2422
[13] malonyl-CoA2296..2300
[13] DH2470..2632
[13] ER2968..3273
[13] KR3283..3463
[13] ACP3568..3638
[12] KS100..1227
[12] AT1711..2667
[12] methylmalonyl-CoA2284..2298
[12] KR3580..4119
[12] ACP4435..4647
[13] KS4714..5841
[13] AT6307..7266
[13] malonyl-CoA6886..6900
[13] DH7408..7896
[13] ER8902..9819
[13] KR9847..10389
[13] ACP10702..10914

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [761-879]  1.5e-69 G3DSA:3.40.366.10 [2296-2410]  3.4e-75 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR006162 Phosphopantetheine attachment site (PTM)
 [1507-1522]  PS00012 [3596-3611]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1479-1549]  20.298 PS50075 [3568-3638]  21.279 PS50075
PS50075   ACP_DOMAIN
 [1478-1552]  4.2e-20 G3DSA:1.10.1200.10 [3568-3642]  1.1e-21 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [1472-1588]  1e-24 SSF47336 [3560-3655]  1.5e-23 SSF47336
SSF47336   ACP-like
 [1482-1548]  1.9e-11 PF00550 [3571-3637]  7.5e-14 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [2956-3102]  8.4e-31 SSF50129
SSF50129   GroES-like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [2988-3043]  6.6e-08 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1194-1372]  1e-61 PF08659 [3283-3461]  3.8e-62 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-284]  2.1e-95 PF00109 [1572-1821]  1.1e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-409]  5.1e-48 PF02801 [1829-1947]  2.9e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [571-889]  2.5e-108 PF00698 [2103-2422]  3.1e-63 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [4-29]  7.6e-11 PF08990
PF08990   Docking
 [2-36]  7.4e-06 SSF101173
SSF101173   Docking domain B of the erythromycin polyketide synthase (DEBS)
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [569-871]  5.7e-65 SSF52151 [2100-2387]  5.4e-69 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [696-761]  9.1e-19 SSF55048 [2230-2295]  4e-17 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [36-296]  6.2e-86 G3DSA:3.40.47.10 [297-460]  2.7e-62 G3DSA:3.40.47.10 [1575-1833]  4.6e-88 G3DSA:3.40.47.10 [1834-1999]  6.9e-62 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [26-460]  7.8e-104 SSF53901 [1564-1999]  2.3e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1194-1414]  4.8e-37 G3DSA:3.40.50.720 [3103-3198]  1e-19 G3DSA:3.40.50.720 [3283-3497]  4.4e-33 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [573-870]  2.9e-117 SM00827 [2104-2402]  3.8e-122 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1480-1552]  1.9e-33 SM00823 [3569-3641]  3.2e-33 SM00823
SM00823   Phosphopantetheine attachment site
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [2470-2632]  9.6e-84 SM00826
SM00826   no description
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-463]  1.1e-216 SM00825 [1574-1999]  1.2e-222 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1194-1373]  9.8e-54 SM00822 [3283-3463]  5e-57 SM00822
SM00822   no description
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [2968-3273]  5.3e-186 SM00829
SM00829   Enoylreductase
SignalP No significant hit
TMHMM No significant hit