close all open/close all

CDS information : Salino_00990


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction174,688 / 181,626 / + [in whole cluster]
174,688 / 181,626 / + [in contig]
Location174688..181626 [in whole cluster]
174688..181626 [in contig]
TypeCDS
Length6,939 bp (2,312 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I modular polyketide synthase
Gene
Gene (GenBank)salAIX
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Related Reference
ACC
H6D577
NITE
Salino3_00210
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)

close this sectionPKS/NRPS Module

14 ethylmalonyl-CoA
15
KS38..411
AT565..887
KR1199..1378
ACP1484..1554
KS1580..1952

close this sectionSequence

selected fasta
>polyketide synthase [type I modular polyketide synthase]
MSTPSTSSDKLVEALRASLTETANLREQNRRLADAPHEPIAVVAMSCRYPGGLESPEELW
EFVLGGGDAVTEFPVNRGWDLDELHGPEAGGSVATEACFVHNADEFDPAFFGISPREALA
MDPQQRLLLESAWETFERAGIDPGTLKGSPTGVFVGATQPAYGQNLTDVPEGVAGHLVTG
GVASVIAGRLSYTFGLEGPAVTLDTACSSSLVALHQAVQALRQGECSMALTGGVTVMATP
GLFVGFSEQQVMAFNGRCKAFAAGADGTGWSEGVGLLLLERLSEARRRNHPVLAVIRGTA
VNQDGASNGLTAPSGRAQQRVIRQALANARLSPQDVDAVEAHGTGTRLGDPIEAHALMAT
YGKERGENPPLLLGSIKSNIGHAQAAAGVGGVIKTVMALQHAKLPKSLHIEEKSPHIDWS
AGAVELLLEPRDWPRSDRPRRAAVSSFGLSGTNAHAILEQAPEAADPAAEATTEPRPALF
SGDPLVPWIVSAKSAGGLEAQRARLGRHVSGRDSLGATDLGYSLAATRAAFEHRAVVLGT
TTEQLRTGLEAPDVAGVSSVSGKTVFVFPGQGSQWAGMAVELLDSSPVFAARFAEVASAV
EAHVDWSVESVVRGADGTPSLDRIEILQPVLFTVMVSLAAVWQSVGVVPDAVVGHSQGEI
AAAAVSGALSLGDAAQVVVLRSQLFADELVGKGAVASVSLPAAEVEARIARFNGDAEVLS
IAGNNGPRSVTVAGQVAALEELVAELEAEGVRAKVIGSTVASHCAQVDPLHERILDLLSF
VEPREGSVPLYSTVNGEVLSGAELDASYWFENCRRPVSFEPVVRALIADGFDVFVESSAH
PVLTYGISETSDDVGVEVLAQGTLRRQEGGPRRVLTSFAEAWTRGVALDWTAVFAGRGAK
AVDLPTYAFQRQSYWLESGSPAAGAPAASAADEVEEAFWAAVESEDLAALTGTVPSLATE
EARTALGELLPALASWRRGHRERSTLDSWRYGITWKPLTAPAARLEGSWLLVTGQEESDG
RAALLAAGLAAHGAETVVLETDPLALGRTALSGQLAEAVATLPELRGILSLVGTGAANGA
ASTLLLVQALADASVQLPLWCATRGAVSVGQGDAPAEPDQAALWGLGRAVALEQPAVWGG
LIDLPETLDERALGRVARVLAGIEEEDQVAIRATGTFGRRLARRPLHDAVPERVWQPRGT
VLVTGGTGGVGAHLARWLADNGAAHLVLTGRRGADAPGAAELAAGIRESGTEVTLAACDA
ADREALAAVLAAVPESAPLTAVVHAAGLPQSTLATDTTYEDFVQLTAGKVEGARHLDALL
GDRELDAFVLFSSSSGVWGAGRHTAYGAANAWLDALAEQRRTRGLTATSVAWGGWSGGMM
ALEGAGEYMRRRGVGEMAPERALAALRQAVEHDETFVAVADVDWEKFAPGFTSERPSALL
TGLPEVRRALAPAAVAAPRQAEESASDLVRSLRAGTPAEREAQLLGLVRTEAASVLGHAG
AEDVEPGRAFREIGFDSLTVVELRNRLSAATGLKLPTTLVFDHPSPLALARFLGGELLGT
EEESAPAGAAPVAAGAHHEDPVVIVGMSCRLPGGVTSPEELWRAVAAGEDLVGDLPADRG
WNTAAAALSADGDPQAVRLLDQAGLLSGIHDFDPAFFGISPEEALVMDPQQRILLEIAWE
AFERAGVDPGELAEEKVGVFAGLGYQGFMPGARIPAESEPHLGSGIGPAFASGRLAYALN
LNGPALTVDTGCSSSAVALHLAVQSVRRGESAMALAGGVTVLSSPVAWHHMGGAAADGRC
KPFSEDADGTGWGEGAAMILVERLSRARELGHEVLAVVRGSAVGHHGASNGLSAPNGASQ
QRLIREALADAGLGAAEIDAVEAHGTGTPLGDAVEAEALLATYGRERPADRPLKLGTVKS
NIGHPQAASGVTGVIKTVLSMRHRLLPGTLNIKEPASRVDWSAGAVELVTEATAWPETGG
PRRAGVSSLGASGTEVHLIIEEAPAAPEHPESTGARPVALPLSGHTPEALRAQARQLGEQ
VRSNPERSPADYAYSMATGRALFRHRAVVVAADRAELLDGLGALAAGEERPGLVAAPAEV
PRTALLFTGRAAESAELRAAFPVFAEVWEEVHAHLDVTLPAPLPDAAEAFAAEVALHRLL
DTWGIAPSVLRGHGRGTLAAAHAAGALGLDGAVALLAALAAGEGEQSVQRALRAAEIAEP
AHRLLTAGGEPLTAERLGDPEFWTAAWAEPDAAPADPAAFEAGAAGAREVLGLAGERYAG
GARIDWTAVFTGSGARRVDLPTYPFQREPHRI
selected fasta
>polyketide synthase [type I modular polyketide synthase]
ATGAGTACCCCAAGTACCTCTTCGGACAAGCTCGTCGAAGCGCTGCGGGCATCCCTGACC
GAGACCGCGAACCTGCGCGAGCAGAACCGCCGCCTCGCCGACGCGCCGCACGAGCCCATC
GCGGTCGTCGCCATGAGCTGCCGCTACCCCGGCGGCCTCGAATCCCCGGAAGAACTCTGG
GAGTTCGTCCTCGGCGGCGGCGACGCCGTCACCGAGTTCCCGGTCAACCGGGGCTGGGAC
CTCGACGAGCTGCACGGCCCCGAGGCGGGCGGCAGCGTCGCCACCGAGGCCTGCTTCGTG
CACAACGCCGACGAGTTCGACCCCGCCTTCTTCGGGATCTCCCCGCGCGAGGCCCTCGCC
ATGGACCCGCAGCAGCGGCTGCTGCTCGAATCGGCCTGGGAGACCTTCGAACGCGCCGGT
ATCGACCCGGGCACCCTCAAGGGCAGCCCGACCGGCGTCTTCGTCGGCGCCACCCAGCCC
GCCTACGGCCAGAACCTCACCGACGTCCCCGAGGGCGTCGCCGGGCACCTGGTCACCGGC
GGCGTCGCCAGCGTCATCGCCGGACGCCTCTCCTACACCTTCGGCCTCGAAGGCCCGGCG
GTCACCCTCGACACCGCCTGCTCCTCCTCCCTGGTCGCCCTCCACCAGGCGGTGCAGGCG
CTGCGCCAGGGCGAATGCTCCATGGCGCTCACCGGCGGCGTCACCGTGATGGCCACCCCC
GGCCTCTTCGTCGGCTTCAGCGAGCAGCAGGTCATGGCCTTCAACGGCCGCTGCAAGGCC
TTCGCCGCCGGAGCCGACGGCACCGGTTGGTCCGAGGGCGTGGGCCTGCTCCTCCTGGAG
CGCCTCTCCGAGGCCCGGCGCAGGAACCACCCCGTGCTCGCCGTCATCCGCGGCACCGCC
GTCAACCAGGACGGCGCCAGCAACGGCCTCACCGCCCCCAGCGGCCGCGCCCAGCAGCGC
GTGATCCGCCAGGCGCTCGCCAATGCCCGGCTCAGCCCCCAGGACGTGGACGCCGTCGAG
GCGCACGGCACCGGTACCCGCCTCGGGGACCCGATCGAGGCGCACGCCCTGATGGCCACG
TACGGCAAGGAGCGCGGCGAGAACCCGCCGCTGCTGCTCGGCTCCATCAAGTCCAACATC
GGCCACGCGCAGGCCGCCGCGGGCGTCGGCGGTGTCATCAAGACCGTGATGGCCCTCCAG
CACGCCAAGCTGCCCAAGTCCCTGCACATCGAGGAGAAGTCCCCGCACATCGACTGGTCC
GCCGGGGCCGTCGAACTCCTCCTCGAACCCCGGGACTGGCCGCGCAGCGACCGGCCCCGC
CGCGCCGCCGTCTCCTCCTTCGGACTCAGCGGCACCAACGCCCACGCCATCCTCGAACAG
GCCCCCGAGGCAGCCGACCCGGCCGCCGAGGCCACCACCGAGCCGCGGCCGGCCCTCTTC
TCGGGCGACCCGCTGGTGCCCTGGATCGTCTCGGCCAAGAGCGCCGGCGGCCTGGAGGCC
CAACGCGCCCGCCTCGGCCGCCACGTGAGCGGCCGCGACTCGCTCGGCGCGACCGACCTC
GGCTACTCCCTCGCCGCCACCCGCGCCGCCTTCGAGCACCGCGCGGTCGTCCTCGGCACC
ACAACCGAGCAGCTGCGTACGGGACTTGAGGCACCGGACGTGGCGGGCGTCTCCTCCGTC
TCCGGCAAGACGGTGTTCGTCTTCCCGGGTCAGGGTTCGCAGTGGGCCGGTATGGCGGTC
GAACTCCTGGACTCCTCCCCGGTGTTCGCGGCCCGGTTCGCCGAAGTCGCCTCCGCCGTC
GAGGCGCATGTGGACTGGTCCGTGGAGTCGGTGGTCCGGGGCGCGGACGGCACCCCGTCG
CTCGACCGCATCGAGATCCTTCAGCCGGTGCTGTTCACGGTCATGGTGTCGCTGGCCGCG
GTCTGGCAGTCGGTCGGGGTCGTCCCGGATGCCGTCGTCGGTCACTCGCAGGGTGAGATC
GCTGCTGCTGCCGTGTCCGGCGCGCTGTCGCTTGGGGATGCGGCTCAAGTGGTGGTGCTG
CGTTCGCAGTTGTTCGCGGATGAGTTGGTCGGCAAGGGTGCGGTGGCGTCGGTTTCCTTG
CCTGCGGCTGAGGTTGAGGCTCGTATCGCGCGTTTCAACGGTGACGCTGAGGTGTTGTCG
ATCGCGGGGAACAATGGTCCGCGTTCGGTGACGGTCGCGGGTCAAGTGGCGGCTCTGGAA
GAGCTGGTGGCCGAGCTGGAGGCGGAAGGTGTCCGGGCGAAGGTGATCGGCTCCACGGTT
GCTTCGCACTGTGCTCAGGTGGACCCGCTGCACGAGCGGATCCTCGATTTGCTGTCGTTC
GTCGAGCCGCGTGAGGGCTCCGTTCCGCTGTACTCGACGGTCAACGGCGAGGTGCTGAGC
GGCGCCGAGTTGGATGCTTCGTACTGGTTCGAGAACTGCCGTCGTCCGGTGAGCTTCGAG
CCGGTCGTACGTGCGCTGATCGCCGACGGTTTCGATGTGTTCGTGGAGTCGAGTGCGCAC
CCGGTGCTGACGTACGGCATCAGTGAGACCTCTGACGATGTGGGTGTGGAGGTGCTTGCG
CAGGGGACGCTGCGGCGTCAAGAAGGCGGCCCCCGCCGGGTGTTGACCTCCTTCGCCGAG
GCCTGGACCCGTGGTGTGGCCCTCGACTGGACCGCGGTCTTCGCGGGACGCGGGGCGAAG
GCGGTGGACCTGCCGACGTACGCCTTCCAGCGGCAGAGCTACTGGCTGGAGTCCGGGAGC
CCGGCGGCGGGGGCTCCGGCCGCGAGCGCCGCCGACGAGGTGGAGGAGGCCTTCTGGGCG
GCCGTCGAGAGCGAGGATCTCGCCGCGCTCACCGGGACCGTGCCGAGCCTGGCCACCGAG
GAGGCCCGTACCGCCCTGGGTGAGCTGCTGCCCGCCCTCGCCTCCTGGCGCCGCGGGCAC
CGGGAGCGCTCCACCCTGGACTCCTGGCGCTACGGCATCACCTGGAAGCCGCTCACCGCG
CCCGCCGCCCGGCTGGAGGGCAGCTGGCTCCTGGTCACCGGGCAGGAGGAGAGCGACGGC
CGGGCCGCGCTGCTCGCCGCGGGGCTGGCCGCGCACGGTGCCGAGACCGTGGTCCTGGAG
ACCGATCCGCTCGCCCTCGGCCGCACCGCGCTCTCCGGTCAGCTCGCCGAGGCCGTCGCC
ACCCTGCCCGAACTGCGCGGCATCCTCTCGCTGGTGGGCACCGGGGCCGCGAACGGCGCT
GCCTCGACTCTCCTTCTGGTGCAGGCACTCGCCGACGCCTCGGTGCAGCTCCCGCTGTGG
TGCGCCACCCGCGGTGCCGTCTCCGTCGGTCAGGGCGACGCCCCGGCGGAGCCCGATCAG
GCCGCGCTCTGGGGCCTCGGCCGGGCCGTCGCCCTCGAACAGCCCGCCGTCTGGGGCGGG
TTGATCGACCTGCCGGAGACCCTCGACGAGCGCGCGCTCGGCCGGGTCGCCCGGGTGCTC
GCCGGAATCGAGGAGGAGGACCAGGTCGCGATCCGCGCCACCGGCACCTTCGGCCGCCGC
CTCGCCCGCCGCCCGCTGCACGACGCCGTACCCGAGCGGGTCTGGCAGCCGCGCGGCACG
GTGCTCGTCACCGGCGGCACCGGGGGAGTGGGCGCCCACCTCGCCCGCTGGCTCGCGGAC
AACGGCGCCGCCCACCTCGTCCTCACCGGCCGCCGCGGCGCCGACGCCCCCGGCGCCGCC
GAACTCGCCGCCGGGATAAGGGAGTCGGGCACCGAGGTCACCCTCGCCGCCTGCGACGCC
GCGGACCGCGAGGCGCTCGCCGCGGTACTGGCGGCCGTCCCGGAGTCCGCGCCGCTGACC
GCGGTGGTGCACGCGGCGGGGCTGCCGCAGTCCACCCTCGCCACGGACACCACGTACGAG
GACTTCGTGCAGCTCACCGCGGGCAAGGTGGAGGGCGCACGCCACCTCGACGCCCTGCTC
GGGGACCGTGAGCTCGACGCCTTCGTGCTCTTCTCCTCCAGCTCCGGCGTCTGGGGCGCC
GGTCGGCACACCGCCTACGGGGCGGCCAACGCCTGGCTCGACGCGCTCGCCGAGCAGCGC
CGGACCCGCGGGCTCACCGCGACCTCGGTGGCCTGGGGCGGCTGGAGCGGCGGCATGATG
GCGCTGGAGGGCGCGGGCGAGTACATGCGCCGGCGCGGAGTCGGCGAGATGGCGCCCGAG
CGGGCGCTGGCCGCACTGCGGCAGGCCGTCGAGCACGACGAGACCTTTGTCGCGGTCGCC
GACGTCGACTGGGAGAAGTTCGCGCCCGGCTTCACCTCGGAGCGGCCGAGCGCCCTGCTC
ACCGGGCTGCCCGAGGTCCGCAGGGCCCTCGCCCCGGCCGCCGTCGCCGCCCCCAGGCAG
GCCGAGGAGTCCGCCTCCGACCTGGTGCGCAGCCTGCGTGCGGGCACGCCCGCCGAACGG
GAGGCACAACTGCTCGGCCTGGTGCGCACCGAGGCCGCCTCGGTGCTCGGGCACGCGGGC
GCCGAGGACGTCGAACCCGGCCGCGCCTTCCGCGAGATCGGCTTCGACTCGCTCACCGTC
GTCGAGCTGCGCAACCGGCTCAGCGCCGCCACCGGCCTGAAGCTGCCCACCACCCTCGTC
TTCGACCACCCGAGCCCGCTGGCGCTCGCCCGCTTCCTCGGCGGCGAACTCCTCGGCACC
GAGGAGGAGTCGGCGCCCGCGGGTGCCGCCCCGGTCGCCGCGGGCGCGCACCACGAGGAC
CCGGTCGTCATCGTCGGCATGAGCTGCCGGCTGCCCGGCGGCGTCACCAGCCCCGAGGAG
CTGTGGCGGGCCGTCGCCGCGGGCGAGGACCTGGTCGGCGACCTGCCGGCGGACCGCGGC
TGGAACACCGCCGCGGCGGCCCTCTCCGCGGACGGCGACCCGCAGGCCGTACGCCTCCTC
GACCAGGCCGGACTGCTCAGCGGCATCCACGACTTCGACCCCGCCTTCTTCGGCATCTCG
CCCGAGGAGGCCCTGGTCATGGACCCGCAGCAGCGGATCCTCCTGGAGATCGCCTGGGAG
GCCTTCGAACGCGCGGGCGTCGACCCCGGGGAGCTGGCCGAGGAGAAGGTCGGCGTCTTC
GCGGGGCTCGGCTACCAGGGCTTCATGCCCGGCGCGCGCATCCCCGCCGAGAGCGAACCG
CACCTGGGCAGCGGCATCGGCCCCGCCTTCGCCTCCGGGCGCCTGGCCTACGCCCTCAAC
CTCAACGGCCCCGCCCTCACCGTGGACACCGGCTGCTCCTCCTCCGCGGTGGCCCTGCAC
CTGGCGGTGCAGTCGGTGCGCCGGGGCGAGAGCGCGATGGCCCTGGCGGGCGGCGTCACC
GTACTGTCCAGCCCGGTGGCCTGGCACCACATGGGCGGCGCCGCCGCCGACGGCCGCTGC
AAGCCCTTCTCGGAGGACGCGGACGGCACCGGCTGGGGCGAGGGCGCGGCGATGATCCTC
GTCGAACGCCTCTCCCGGGCCCGCGAGTTGGGCCACGAGGTGCTGGCCGTGGTGCGCGGT
TCCGCGGTCGGCCACCACGGCGCGAGCAACGGCCTCTCCGCGCCCAACGGCGCCTCCCAG
CAGCGGCTGATCCGCGAGGCGCTGGCCGACGCCGGGCTCGGCGCGGCCGAGATCGACGCG
GTCGAGGCGCACGGCACCGGCACCCCGCTCGGCGACGCGGTCGAGGCGGAGGCGCTGCTC
GCCACCTACGGGCGGGAGCGGCCCGCGGACCGTCCGCTGAAGCTCGGCACGGTGAAGTCC
AACATCGGCCATCCGCAGGCCGCTTCGGGCGTCACCGGGGTCATCAAGACCGTCCTGTCG
ATGCGCCACCGGCTGCTGCCGGGCACCCTCAACATCAAGGAGCCCGCGAGCCGCGTGGAC
TGGTCGGCGGGCGCCGTCGAACTCGTCACCGAGGCCACCGCCTGGCCGGAGACGGGCGGA
CCGCGCCGGGCGGGCGTCTCCTCCCTCGGCGCCAGCGGCACCGAGGTGCACCTGATCATC
GAGGAGGCACCCGCGGCCCCCGAGCATCCGGAGAGCACCGGGGCCCGCCCCGTGGCGCTG
CCGCTCTCCGGCCACACCCCCGAGGCGCTGCGGGCCCAGGCCCGGCAGCTGGGCGAGCAG
GTGCGGAGCAACCCCGAGCGCAGCCCCGCCGACTACGCGTACTCGATGGCGACCGGCCGC
GCCCTGTTCCGGCACCGCGCGGTGGTCGTCGCCGCCGACCGTGCCGAACTCCTCGACGGG
CTCGGGGCCTTGGCCGCGGGCGAGGAGCGCCCCGGCCTGGTCGCGGCCCCGGCCGAAGTG
CCGCGTACCGCCCTGCTGTTCACCGGCCGGGCGGCGGAGAGCGCCGAACTGCGGGCGGCC
TTCCCGGTGTTCGCCGAGGTCTGGGAGGAGGTGCACGCCCACCTGGACGTGACCCTGCCC
GCCCCGCTGCCCGACGCGGCCGAGGCCTTCGCCGCGGAGGTCGCGCTGCACCGGCTCCTG
GACACCTGGGGCATCGCGCCCTCGGTGCTGCGCGGCCACGGCCGGGGCACCCTCGCCGCC
GCGCACGCCGCCGGGGCCCTCGGGCTCGACGGTGCCGTGGCCCTGCTCGCCGCCCTCGCG
GCGGGCGAGGGGGAGCAGTCCGTACAACGGGCCCTGCGGGCCGCGGAGATCGCCGAGCCC
GCGCACCGGCTGCTGACCGCCGGGGGCGAACCGCTCACCGCGGAGCGGCTCGGCGACCCG
GAGTTCTGGACGGCGGCCTGGGCCGAGCCGGACGCGGCGCCCGCTGACCCGGCCGCCTTC
GAGGCGGGAGCCGCCGGCGCCCGCGAGGTCCTCGGCCTCGCGGGGGAGCGCTACGCGGGC
GGCGCCCGCATCGACTGGACCGCGGTGTTCACCGGCTCGGGAGCGCGCCGGGTGGACCTG
CCGACCTACCCGTTCCAGCGGGAGCCGCACCGGATCTGA
[14] KS38..411
[14] AT565..887
[14] ethylmalonyl-CoA760..764
[14] KR1199..1378
[14] ACP1484..1554
[15] KS1580..1952
[14] KS112..1233
[14] AT1693..2661
[14] ethylmalonyl-CoA2278..2292
[14] KR3595..4134
[14] ACP4450..4662
[15] KS4738..5856

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [759-876]  3.5e-65 G3DSA:3.40.366.10 [2097-2198]  2.1e-08 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR006162 Phosphopantetheine attachment site (PTM)
 [1512-1527]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1484-1554]  18.77 PS50075
PS50075   ACP_DOMAIN
 [1488-1553]  9.4e-12 PF00550
PF00550   PP-binding
 [1483-1557]  5.9e-18 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [1477-1596]  2.8e-26 SSF47336
SSF47336   ACP-like
IPR013968 Polyketide synthase, KR (Domain)
 [1199-1377]  4.6e-59 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [38-285]  1.5e-89 PF00109 [1580-1827]  3.4e-74 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [293-411]  2.5e-45 PF02801 [1835-1952]  1.9e-41 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [565-887]  3e-89 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [563-869]  1.1e-62 SSF52151 [2102-2201]  9.7e-13 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [691-759]  3.1e-12 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [38-296]  2.8e-83 G3DSA:3.40.47.10 [297-463]  3.1e-62 G3DSA:3.40.47.10 [1580-1838]  2.1e-73 G3DSA:3.40.47.10 [1839-2005]  8.5e-54 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [30-409]  2.2e-95 SSF53901 [1572-1948]  2.2e-88 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1452-1453]  4.3e-35 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [198-214]  PS00606 [1743-1759]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [567-868]  1.5e-95 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1485-1557]  6.5e-32 SM00823
SM00823   Phosphopantetheine attachment site
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [40-463]  2.2e-206 SM00825 [1582-2005]  9e-164 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1199-1378]  9.2e-49 SM00822
SM00822   no description
SignalP No significant hit
TMHMM No significant hit