close all open/close all

CDS information : Salino_01000


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction181,715 / 182,101 / + [in whole cluster]
181,715 / 182,101 / + [in contig]
Location181715..182101 [in whole cluster]
181715..182101 [in contig]
TypeCDS
Length387 bp (128 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase
Product (GenBank)putative epoxide hydrolase/cyclase
Gene
Gene (GenBank)salBIII
EC number
Keyword
  • tetrahydropyran ring
Note
Note (GenBank)
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
[26377145] Enzymology of Pyran Ring A Formation in Salinomycin Biosynthesis. (Angew Chem Int Ed Engl. , 2015)
Related Reference
ACC
H6D578
NITE
Salino3_00220
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)

close this sectionSequence

selected fasta
>cyclase [putative epoxide hydrolase/cyclase]
MQDEQKRKEIVAEYFRKVNEGDVDAIVEMFTENATIEDPVGKDVREGRAAQREYFNSNVT
AEVTIEPGHLSAGQDGKSVAVALAAEMTNILDPNRTRVKINAVDVFTLTPEGKIDSMRVF
WGMTDIGV
selected fasta
>cyclase [putative epoxide hydrolase/cyclase]
ATGCAGGACGAGCAGAAGCGCAAGGAGATCGTCGCGGAATACTTCCGCAAGGTGAACGAG
GGCGATGTCGACGCCATCGTCGAGATGTTCACCGAGAACGCCACCATCGAGGACCCGGTC
GGCAAGGATGTCCGCGAGGGCCGCGCAGCGCAGCGCGAGTACTTCAACAGCAATGTCACC
GCCGAGGTCACCATCGAGCCGGGACACCTGTCGGCGGGTCAGGACGGCAAGTCCGTCGCC
GTCGCCCTGGCCGCGGAGATGACCAACATCCTCGACCCCAACCGCACCCGTGTGAAGATC
AACGCCGTCGACGTCTTCACCCTCACCCCCGAGGGCAAGATCGACAGCATGCGCGTGTTC
TGGGGCATGACCGACATCGGCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009959 Polyketide cyclase SnoaL-like domain (Domain)
 [11-114]  3.1e-13 PF12680
PF12680   SnoaL_2
SignalP No significant hit
TMHMM No significant hit