close all open/close all

CDS information : Salino_01010


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction182,143 / 182,940 / + [in whole cluster]
182,143 / 182,940 / + [in contig]
Location182143..182940 [in whole cluster]
182143..182940 [in contig]
TypeCDS
Length798 bp (265 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)thioesterase
GenesalGI
Gene (GenBank)salGII
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Related Reference
ACC
H6D579
NITE
Salino3_00230
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)

close this sectionSequence

selected fasta
>putative type II thioesterase [thioesterase]
MSTQRTQGSQDADDELWVRRFHPAPEKPVRLVCLPHAGGSASFFFPFSAALAPHADVLAI
QYPGRQDRRGEPLLGTVQELTDAVLEALRPWHDRPLVFFGHSMGAVLSFELARRFEREGA
PVQGLIASGRRAPTVHREENVHQRGDDALIAEIRALSGTDTGLLADEELLRMVLPAIRSD
YKAIETYRYRPDGTQPPLTSPVSVLTGESDPRVSIPEAQAWQELSSGKFTFRSFPGGHFY
LTPRQAEVTRAVAEDLAAFARVPAN
selected fasta
>putative type II thioesterase [thioesterase]
ATGAGCACGCAGCGCACACAGGGCAGTCAGGACGCCGACGACGAGCTGTGGGTACGGCGC
TTCCACCCCGCACCCGAGAAGCCGGTACGCCTGGTGTGCCTGCCGCACGCCGGTGGCTCC
GCGTCCTTCTTCTTCCCGTTCTCGGCAGCGCTCGCCCCTCACGCCGACGTCCTGGCGATC
CAGTACCCGGGCCGCCAGGACCGGCGGGGCGAGCCGCTGCTCGGCACCGTCCAGGAGCTG
ACCGACGCCGTCCTCGAGGCGCTGCGGCCCTGGCACGACCGGCCGCTGGTGTTCTTCGGC
CACAGCATGGGCGCGGTGCTCTCCTTCGAGCTGGCCCGCCGCTTCGAGCGCGAGGGCGCC
CCGGTGCAGGGGCTCATCGCCTCCGGGCGCCGGGCCCCCACGGTGCACCGCGAGGAGAAC
GTGCACCAGCGCGGCGACGACGCGCTGATCGCGGAGATCCGCGCGCTGAGCGGCACGGAC
ACCGGGCTGCTCGCCGACGAGGAGCTGCTGCGGATGGTGCTGCCCGCGATCCGCAGCGAC
TACAAGGCCATCGAGACCTACCGCTACCGGCCAGACGGGACCCAGCCGCCGCTGACCTCG
CCCGTCAGCGTGCTCACCGGGGAGTCCGACCCGCGGGTCAGCATTCCCGAGGCGCAGGCC
TGGCAGGAGCTCAGCAGCGGGAAGTTCACCTTCCGCAGCTTCCCCGGCGGCCACTTCTAT
CTGACGCCGCGCCAGGCGGAGGTGACCCGCGCGGTGGCCGAGGACCTGGCCGCCTTCGCC
CGGGTCCCGGCGAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [30-254]  7.9e-56 PF00975
PF00975   Thioesterase
IPR020802 Polyketide synthase, thioesterase domain (Domain)
 [32-256]  2.7e-05 SM00824
SM00824   Thioesterase
SignalP No significant hit
TMHMM No significant hit