close all open/close all

CDS information : Salino_01020


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction182,981 / 183,796 / + [in whole cluster]
182,981 / 183,796 / + [in contig]
Location182981..183796 [in whole cluster]
182981..183796 [in contig]
TypeCDS
Length816 bp (271 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative dehydratase
Product (GenBank)putative O-methyltransferase
Gene
Gene (GenBank)salE
EC number
Keyword
  • C18-19
Note
Note (GenBank)
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
[25155178] Site-specific modification of the anticancer and antituberculosis polyether salinomycin by biosynthetic engineering. (Chembiochem. , 2014)
Related Reference
ACC
H6D580
NITE
Salino3_00240
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
[26096919] Formation of the Delta(18,19) Double Bond and Bis(spiroacetal) in Salinomycin Is Atypically Catalyzed by SlnM, a Methyltransferase-like Enzyme. (Angew Chem Int Ed Engl. , 2015)

close this sectionSequence

selected fasta
>putative dehydratase [putative O-methyltransferase]
METKPAQFTAETENLLIALYSRAHDAKSAKPILNDRMAVTVSESIEYDYAKLKIRDDDAI
SLAIRGELIDGWIRSFLDAHPDAVVLHLGTGLDGRVHRMDPPASVEWYDLDLPEIAALYA
QLFPEREHHHVIGSSVMDLKWLEQVPTDRPTVIVAEGLLVYFTEEEVKGLIRKLFSVFPS
GQLIFDAYTPFSVKAMNKHWTVKASGKRFVWGLAEPASLEQWHPGVKHHDAWTFFGSPYI
AHMPWTSRVVCKIMNAIPALRHYNRVMRYSF
selected fasta
>putative dehydratase [putative O-methyltransferase]
ATGGAGACGAAGCCGGCGCAGTTCACGGCCGAGACCGAGAACCTCCTCATCGCGCTCTAC
TCCCGCGCCCACGACGCCAAGTCGGCCAAGCCCATCCTCAACGACCGGATGGCGGTCACG
GTCAGCGAGTCGATCGAGTACGACTACGCCAAGCTGAAGATCCGCGACGACGACGCCATC
AGCCTCGCCATCCGCGGTGAGCTGATCGACGGCTGGATCCGGAGCTTCCTGGACGCCCAC
CCGGACGCGGTCGTACTGCACCTGGGCACCGGTCTCGACGGCCGCGTCCACCGGATGGAC
CCGCCCGCCTCCGTGGAGTGGTACGACCTGGACCTGCCGGAGATCGCCGCGCTGTACGCG
CAGCTCTTCCCCGAGCGGGAGCACCACCACGTCATCGGCTCCTCGGTGATGGACCTCAAG
TGGCTGGAGCAGGTGCCCACCGACCGGCCCACCGTCATCGTGGCCGAGGGCCTGCTCGTG
TACTTCACCGAGGAGGAGGTCAAGGGGCTGATCCGCAAGCTCTTCTCGGTGTTCCCGAGC
GGCCAGCTGATCTTCGACGCGTACACGCCCTTCTCGGTGAAGGCGATGAACAAGCACTGG
ACGGTCAAGGCCTCCGGCAAGCGCTTCGTCTGGGGCCTGGCCGAGCCCGCCTCCCTGGAG
CAGTGGCACCCGGGCGTCAAGCACCATGACGCCTGGACCTTCTTCGGCTCGCCCTATATC
GCGCACATGCCGTGGACCTCCCGCGTGGTCTGCAAGATCATGAACGCGATACCGGCGCTG
CGGCACTACAACCGCGTGATGCGCTACTCCTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007213 Leucine carboxyl methyltransferase (Family)
 [16-174]  5.7e-38 PF04072
PF04072   LCM
SignalP
 [1-23]  0.119 Signal
Bacteria, Gram-negative   
TMHMM No significant hit