close all open/close all

CDS information : Salino_01030


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction184,272 / 183,991 / - [in whole cluster]
184,272 / 183,991 / - [in contig]
Locationcomplement(183991..184272) [in whole cluster]
complement(183991..184272) [in contig]
TypeCDS
Length282 bp (93 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.5 electron carrier
Productputative ferredoxin
Product (GenBank)ferredoxin
Gene
Gene (GenBank)salF
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Related Reference
ACC
H6D581
NITE
Salino3_00250
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
Family/Domain
FD
IPR001080

close this sectionSequence

selected fasta
>putative ferredoxin [ferredoxin]
MSAAGTPTAREETGGGSRDGDWEVSVDRLSCTGTGMCVHAAPAFFGLVGGRSQALGSPVE
PDETVLDAAENCPLEAIRVTERATGRVLAPEEF
selected fasta
>putative ferredoxin [ferredoxin]
GTGAGCGCCGCGGGGACGCCGACCGCGCGGGAGGAGACCGGCGGCGGGTCGCGGGACGGC
GACTGGGAGGTCAGCGTCGACCGGCTGTCCTGCACCGGCACCGGCATGTGCGTCCACGCG
GCGCCCGCCTTCTTCGGCCTGGTGGGCGGCCGTTCGCAGGCGCTCGGCTCCCCCGTGGAG
CCCGACGAGACGGTGCTGGACGCCGCCGAGAACTGCCCCCTGGAGGCCATCCGCGTCACC
GAACGGGCCACCGGACGGGTGCTGGCGCCCGAGGAGTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001080 3Fe-4S ferredoxin (Family)
 [26-37]  6.1e-05 PR00352 [37-47]  6.1e-05 PR00352 [65-77]  6.1e-05 PR00352
PR00352   3FE4SFRDOXIN
SignalP No significant hit
TMHMM No significant hit