close all open/close all

CDS information : Salino_01060


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction186,625 / 188,265 / + [in whole cluster]
186,625 / 188,265 / + [in contig]
Location186625..188265 [in whole cluster]
186625..188265 [in contig]
TypeCDS
Length1,641 bp (546 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter permease protein
Product (GenBank)antibiotic ABC transporter efflux pump
Gene
Gene (GenBank)salI
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Related Reference
ACC
Q54407
PmId
[8196549] An ABC-transporter from Streptomyces longisporoflavus confers resistance to the polyether-ionophore antibiotic tetronasin. (Mol Microbiol. , 1994)
ACC
H6D584
NITE
Salino3_00280
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)

close this sectionSequence

selected fasta
>putative ABC transporter permease protein [antibiotic ABC transporter efflux pump]
MSEKSPYTGTQALLKLATRRDRIQLAVWMYGTAALAYSAANSVKSTYENEKARVDAVQLL
SDNPALLLTRGAPVGSSQGAVSMVQVFSYLCVLAALMSTMAVVRHTRQNEETGRAELIGA
QPVGRQAGLMAALLLALQANIGLFIFLGIVLPLAGLPIGGSLAAAAAVASVGLAFAGVAA
VTAQLAGTARGANSLAGAAIGAAFLIRGVGDALGDVTGNGTVVHSAWPSWLSPIGWGTLV
HPFGDERWWVLALPLAFALLTMGLALRLSAERDLGAGLLADRPGPAEAPRALLSPLGLAW
RLQRGALLGWLVGIAVLGATIGAIGKSAADALKDNADLTDTLGKIGGGGTDDPAGVFFAS
MMVMVGAVAAGFTVQALLRLRAEETSGRLEAVLATSVSRGRWVAGHVLVAVLGVVALLLV
SGLAAGLTYGAATSDLGQALSDLTGAALAQAPAALVLAGFVVVVFGAVPGLTSGAAWGGL
ALCLVVGQLGGLLKLPQAVRDLSPFTHLPALPAAEAEALPFIVLLAVAAVLAAAGAALFR
RRDLAP
selected fasta
>putative ABC transporter permease protein [antibiotic ABC transporter efflux pump]
ATGAGCGAGAAGTCCCCCTACACCGGTACGCAGGCGCTGCTGAAGCTCGCCACGCGCCGC
GACCGGATCCAGCTCGCGGTGTGGATGTACGGCACGGCCGCCCTCGCCTACAGCGCGGCC
AACAGCGTCAAGAGCACGTATGAGAACGAGAAGGCGCGTGTTGACGCCGTCCAGTTGCTT
TCGGACAACCCGGCGCTCCTGCTGACCCGCGGCGCGCCCGTCGGCAGCAGCCAGGGCGCT
GTCTCGATGGTGCAGGTCTTCTCCTATCTGTGCGTGCTCGCCGCCCTGATGAGCACGATG
GCCGTGGTGCGCCACACCCGGCAGAACGAGGAGACCGGCCGCGCCGAACTCATCGGCGCC
CAGCCGGTGGGCCGCCAGGCCGGTCTGATGGCCGCCCTGCTGCTCGCCCTCCAGGCCAAT
ATCGGCCTCTTCATCTTCCTCGGCATCGTGCTGCCGCTGGCCGGTCTGCCGATCGGCGGC
TCGCTCGCCGCGGCGGCCGCCGTCGCCAGTGTCGGCCTCGCCTTCGCCGGTGTCGCCGCC
GTCACCGCCCAGCTCGCCGGTACCGCGCGCGGCGCCAACTCCCTTGCCGGGGCGGCGATC
GGCGCGGCCTTCCTGATCCGCGGCGTCGGCGACGCGCTCGGCGACGTCACCGGGAACGGC
ACGGTCGTCCACAGCGCCTGGCCGTCCTGGCTCTCGCCGATCGGCTGGGGCACCCTGGTG
CACCCCTTCGGCGACGAGCGCTGGTGGGTGCTCGCCCTGCCGCTCGCCTTCGCGCTGCTC
ACCATGGGGCTCGCGCTGCGGCTTTCGGCCGAGCGCGACCTCGGTGCGGGCCTCCTCGCG
GACCGGCCGGGACCGGCCGAGGCGCCGCGGGCCCTGCTCAGCCCGCTCGGCCTCGCCTGG
CGGCTGCAGCGCGGCGCCCTGCTCGGCTGGCTCGTCGGCATCGCCGTCCTGGGCGCCACC
ATCGGCGCGATCGGCAAGTCGGCCGCCGACGCCCTCAAGGACAACGCCGACCTCACCGAC
ACCCTCGGCAAGATCGGCGGCGGGGGTACGGACGACCCCGCGGGCGTCTTCTTCGCCTCC
ATGATGGTGATGGTGGGCGCCGTCGCCGCCGGGTTCACCGTGCAGGCGCTCCTGAGACTG
CGGGCCGAGGAGACCTCGGGGCGCCTGGAGGCCGTGCTCGCCACCTCGGTGAGCCGGGGC
CGCTGGGTCGCCGGCCATGTCCTGGTCGCCGTGCTCGGCGTGGTGGCTTTGCTGCTCGTC
TCCGGACTCGCCGCCGGCCTCACCTACGGCGCCGCCACCTCGGATCTCGGGCAGGCCCTC
AGCGACCTGACCGGCGCCGCGCTCGCCCAGGCCCCCGCCGCGCTCGTCCTCGCCGGGTTC
GTGGTCGTCGTCTTCGGCGCGGTGCCGGGCCTCACCTCGGGCGCCGCCTGGGGCGGACTC
GCCCTGTGCCTGGTCGTCGGACAGCTCGGCGGACTGCTGAAGCTGCCGCAGGCGGTGCGC
GACCTCTCGCCGTTCACGCACCTGCCCGCGCTGCCCGCGGCCGAGGCCGAGGCGCTGCCC
TTCATCGTCCTGCTCGCGGTGGCCGCGGTGCTCGCGGCGGCCGGTGCCGCCCTCTTCCGC
AGGCGCGACCTCGCCCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-36]  0.356 Signal
Bacteria, Gram-positive   
TMHMM
 [81-103]  Transmembrane (o-i) [129-151]  Transmembrane (i-o) [156-178]  Transmembrane (o-i) [191-210]  Transmembrane (i-o) [248-270]  Transmembrane (o-i) [306-325]  Transmembrane (i-o) [356-378]  Transmembrane (o-i) [409-431]  Transmembrane (i-o) [446-468]  Transmembrane (o-i) [475-497]  Transmembrane (i-o) [517-539]  Transmembrane (o-i)
Transmembrane 11