close all open/close all

CDS information : Salino_01070


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction188,886 / 188,437 / - [in whole cluster]
188,886 / 188,437 / - [in contig]
Locationcomplement(188437..188886) [in whole cluster]
complement(188437..188886) [in contig]
TypeCDS
Length450 bp (149 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative epoxide hydrolase/cyclase
Product (GenBank)putative epoxide hydrolase/cyclase
Gene
Gene (GenBank)salBI
EC number
Keyword
Note
  • Belongs to polyether epoxide hydrolase(PEH)-B group.
Note (GenBank)
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Related Reference
ACC
H6D585
NITE
Salino3_00290
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
ACC
B6ZK72
NITE
Lasal_00210
PmId
[18710235] Epoxide hydrolase Lsd19 for polyether formation in the biosynthesis of lasalocid A: direct experimental evidence on polyene-polyepoxide hypothesis in polyether biosynthesis. (J Am Chem Soc. , 2008)
[21375229] Enzymatic epoxide-opening cascades catalyzed by a pair of epoxide hydrolases in the ionophore polyether biosynthesis. (Org Lett. , 2011)
[22388816] Enzymatic catalysis of anti-Baldwin ring closure in polyether biosynthesis. (Nature. , 2012)
ACC
Q846W7
NITE
Monen_00240
PmId
[16632258] Evidence for the role of the monB genes in polyether ring formation during monensin biosynthesis. (Chem Biol. , 2006)

close this sectionSequence

selected fasta
>putative epoxide hydrolase/cyclase [putative epoxide hydrolase/cyclase]
MLDEATRKELALEHCRRMTSGDVDHMLGLYTKDVRFEDPVGSVPMIGHDELRPHFQRAAE
AKTVDVAGIPVAAQDGIHVAIPVAVYMNYLPLGPTLTKHGYLDKPTNPFQKRIKFDLTSI
FRTGSHGLIEAVWVYWGKSDLSLLDPGEE
selected fasta
>putative epoxide hydrolase/cyclase [putative epoxide hydrolase/cyclase]
ATGCTTGACGAGGCGACGCGGAAAGAACTCGCGCTCGAACACTGCCGCCGCATGACGAGT
GGCGACGTGGATCACATGCTCGGCCTCTATACGAAGGACGTGCGTTTCGAGGACCCGGTC
GGCTCGGTTCCGATGATCGGGCACGACGAATTGCGGCCGCATTTCCAGCGGGCCGCGGAG
GCGAAGACGGTCGATGTCGCCGGAATTCCCGTCGCCGCCCAGGACGGTATCCATGTGGCC
ATCCCGGTCGCCGTCTACATGAATTATCTCCCGCTCGGCCCCACGCTGACGAAACACGGC
TATCTAGACAAGCCCACCAACCCGTTTCAGAAGCGCATCAAGTTCGATCTCACGAGCATT
TTCCGCACCGGCTCGCACGGCCTCATCGAGGCGGTGTGGGTCTATTGGGGGAAATCGGAC
CTGAGCCTGCTCGACCCCGGCGAGGAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009959 Polyketide cyclase SnoaL-like domain (Domain)
 [14-129]  1.8e-08 PF12680
PF12680   SnoaL_2
SignalP No significant hit
TMHMM No significant hit