close all open/close all

CDS information : Salino_01100


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction191,504 / 194,224 / + [in whole cluster]
191,504 / 194,224 / + [in contig]
Location191504..194224 [in whole cluster]
191504..194224 [in contig]
TypeCDS
Length2,721 bp (906 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)LuxR family transcriptional regulator
Gene
Gene (GenBank)salJ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Related Reference
ACC
H6D588
NITE
Salino3_00320
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
ACC
Q9S0N8
NITE
Aver_00010
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[19148632] Characterization of a regulatory gene, aveR, for the biosynthesis of avermectin in Streptomyces avermitilis. (Appl Microbiol Biotechnol. , 2009)
[20012992] The pathway-specific regulator AveR from Streptomyces avermitilis positively regulates avermectin production while it negatively affects oligomycin biosynthesis. (Mol Genet Genomics. , 2010)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [LuxR family transcriptional regulator]
MTLYDRDKEFTRVEKALDSTFSGTAGIVLLEGAVGCGRTEFLKECADLAQERGARVLYGG
AEGEALPHGLLRRLLAPLAPRGGQQRSIPTHQEFAETLAEAAEDAPVVLCVDDFPHADGP
SLGYLLHLARVVRRQRILLILTGPLHERTDSPVLGTELLRHPGFVRIPLTHLSPAGTAAL
LAEHAGAPVAAPPAERLHALSGGNPLLLRALLAEQPLPQRESQEWPAPEAGGPFTKALLT
CLHRSGSGVRELARAVAVLGEHATPELAARLAGTTPSRARQGLTALESAGLTRDCRLSHP
AVAAAVLDDLPAAERTALHGRAAHILDEAGVRAASVARHLLAAGTAEGPRAVRVLHEAAR
QSLVTGDDSRHAVACLELARSGCADESTDWDLDLRLAAVTWRFDPAAAEAHLKGPLAALR
AARLGAAAAGHLARLLVTQGRIEEAAEALEYLARATGSGGGAQCTREDPLRGLFALPPTE
DKPAPAPAAGESGAEQPAEPVRTVSAELRSSASLWTHPGTQADEQAIDKLLEGTPLAQST
FDPMVQAVRTLVHTDHADRAVTWCRTLRPEGSTAPGWNAVFGYLQAEAQLRLGDLAGAEQ
QAEAAMEAVADRGGLFQFGPLATLVLAQTARGSYDAVARQLQTSVPEELFTSVYSLNFLR
ARGHYYLATHRHKAALGEFLDAGRLARRWGLDRPQQLPWRTDAAEALLALGEHRQAERFV
LEQLATPDARGPRLRGVTLRLRAATTPLRQRPKLLTRAVDELRRSGDRFELARALADLGR
SLQMMGEGTRAAMVTRRAWHLAAQCGAVPLAEQILPGQGGQDRKPNTPEKEPAEAGASDT
DQLSESEKRVVSLAAYGYTNREISAKLYITVSTVEQHLTRVYRKLNITRRQELPMDLHFE
TLEHAG
selected fasta
>putative LuxR family transcriptional regulator [LuxR family transcriptional regulator]
GTGACTCTTTACGACCGTGACAAGGAATTCACACGCGTCGAAAAGGCGCTCGACTCAACT
TTTTCCGGGACGGCCGGAATCGTCCTTCTGGAGGGGGCGGTCGGCTGCGGCCGCACCGAG
TTCCTCAAGGAGTGCGCCGACCTCGCCCAGGAGCGCGGCGCCCGCGTCCTGTACGGCGGC
GCCGAGGGCGAGGCACTCCCGCACGGACTGCTGCGCAGGCTGCTCGCCCCGCTGGCCCCG
CGCGGCGGACAGCAGCGGAGCATCCCGACCCACCAGGAGTTCGCCGAGACCCTCGCCGAG
GCGGCCGAGGACGCACCGGTGGTCCTGTGCGTCGACGACTTCCCGCACGCCGACGGGCCC
TCCCTCGGCTACCTCCTCCACCTCGCCCGCGTGGTGCGCCGCCAGCGGATCCTGCTGATC
CTCACCGGCCCCCTGCACGAGCGCACCGACAGCCCCGTCCTCGGCACCGAACTGCTGCGC
CACCCCGGCTTCGTACGGATCCCGCTCACCCATCTGAGCCCCGCCGGAACCGCCGCGCTC
CTCGCCGAGCACGCCGGTGCCCCGGTGGCCGCGCCGCCCGCGGAGCGGCTGCACGCCCTC
AGCGGCGGCAACCCGCTGCTGCTGCGCGCCCTGCTCGCCGAACAGCCCCTGCCGCAGCGG
GAGTCGCAGGAGTGGCCCGCGCCCGAAGCCGGGGGCCCCTTCACCAAGGCGCTGCTCACC
TGCCTGCACCGCAGCGGCTCCGGAGTACGCGAACTGGCCCGCGCCGTCGCGGTCCTCGGT
GAGCACGCCACCCCGGAACTGGCGGCCCGGCTGGCCGGCACCACCCCCAGCCGCGCCCGG
CAGGGCCTGACCGCCCTGGAGAGCGCGGGCCTGACCCGCGACTGCCGCCTGAGCCACCCG
GCCGTGGCCGCCGCCGTCCTCGACGACCTGCCCGCGGCCGAACGCACCGCCCTGCACGGC
CGCGCCGCGCACATCCTCGACGAGGCCGGGGTACGGGCCGCTTCGGTCGCCCGGCACCTG
CTCGCCGCCGGGACCGCCGAGGGCCCCCGGGCGGTGCGCGTGCTCCACGAGGCCGCCCGG
CAGTCCCTGGTCACCGGCGACGACTCCCGGCACGCGGTGGCCTGCCTGGAACTGGCCCGC
AGCGGCTGCGCGGACGAGAGCACCGACTGGGACCTCGACCTGCGGCTCGCCGCCGTCACC
TGGCGCTTCGACCCGGCAGCCGCCGAGGCGCACCTGAAGGGCCCGCTCGCCGCGCTGCGC
GCCGCACGCCTCGGCGCGGCCGCCGCCGGGCACCTCGCCCGGCTCCTGGTCACCCAGGGG
CGGATCGAGGAGGCCGCCGAGGCCCTGGAATACCTGGCCCGCGCCACCGGTTCCGGCGGC
GGGGCCCAGTGCACCCGGGAGGACCCGCTGCGCGGACTCTTCGCGCTGCCGCCCACCGAG
GACAAGCCCGCGCCCGCCCCGGCCGCCGGGGAGAGCGGCGCCGAGCAGCCCGCCGAGCCG
GTGCGCACGGTCTCCGCCGAGCTGCGCTCCTCGGCCTCGCTGTGGACCCACCCGGGCACC
CAGGCCGACGAGCAGGCCATCGACAAGCTCCTCGAAGGCACCCCGCTGGCCCAGAGCACC
TTCGACCCGATGGTCCAGGCGGTCCGCACCCTGGTGCACACCGACCACGCCGACCGCGCG
GTGACCTGGTGCCGGACGCTGCGCCCCGAGGGCAGCACCGCCCCCGGCTGGAACGCCGTC
TTCGGCTACCTCCAGGCCGAGGCGCAGCTGCGCCTCGGCGACCTCGCGGGCGCGGAGCAG
CAGGCCGAGGCCGCGATGGAGGCGGTCGCCGACCGCGGCGGCCTCTTCCAGTTCGGTCCG
CTCGCCACCCTCGTGCTCGCGCAGACCGCGCGGGGCAGCTACGACGCGGTGGCCCGCCAG
CTCCAGACCTCCGTGCCCGAGGAGCTCTTCACCAGCGTCTACTCCCTCAACTTCCTGCGC
GCCCGCGGCCATTACTACCTGGCGACCCACCGCCACAAGGCCGCGCTCGGGGAGTTCCTC
GACGCGGGCAGGCTGGCCCGCCGCTGGGGCCTGGACCGGCCGCAGCAGCTGCCCTGGCGC
ACCGACGCCGCCGAGGCGCTGCTCGCCCTCGGGGAGCACCGGCAGGCCGAGCGCTTCGTC
CTCGAACAGCTCGCCACCCCGGACGCCCGCGGCCCCCGGCTGCGCGGGGTCACCCTGCGG
CTGAGGGCGGCGACCACCCCGCTGCGCCAGCGCCCCAAGCTGCTGACCCGCGCGGTCGAC
GAACTCCGCCGCTCCGGCGACCGCTTCGAACTCGCCCGCGCCCTCGCCGACTTGGGCCGC
TCGCTGCAGATGATGGGGGAGGGCACCCGGGCCGCCATGGTCACCCGGCGCGCCTGGCAC
CTGGCCGCGCAGTGCGGGGCCGTCCCGCTCGCCGAGCAGATACTCCCCGGCCAGGGCGGC
CAGGACCGCAAGCCGAACACCCCCGAGAAGGAGCCCGCCGAGGCCGGCGCGAGCGACACC
GACCAGCTCAGCGAGTCGGAGAAGCGGGTGGTCTCGCTGGCCGCCTACGGCTACACCAAC
CGGGAGATCTCGGCGAAGCTCTACATCACCGTGAGCACCGTCGAACAGCACCTCACCCGC
GTCTACCGCAAGCTCAACATCACCCGCCGCCAGGAACTGCCGATGGACCTGCACTTCGAG
ACCCTGGAGCACGCGGGTTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [841-893]  3.7e-11 PF00196
PF00196   GerE
 [843-857]  4.2e-09 PR00038 [857-873]  4.2e-09 PR00038 [873-885]  4.2e-09 PR00038
PR00038   HTHLUXR
 [857-884]  PS00622
PS00622   HTH_LUXR_1
 [836-902]  14.833 PS50043
PS50043   HTH_LUXR_2
 [840-897]  1.3e-17 SM00421
SM00421   helix_turn_helix, Lux Regulon
IPR011990 Tetratricopeptide-like helical (Domain)
 [760-851]  7.4e-13 G3DSA:1.25.40.10
G3DSA:1.25.40.10   no description
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [852-893]  1.7e-15 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [821-893]  1.4e-13 SSF46894
SSF46894   C-terminal effector domain of the bipartite response regulators
SignalP No significant hit
TMHMM No significant hit