close all open/close all

CDS information : Salino_01110


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction194,452 / 195,213 / + [in whole cluster]
194,452 / 195,213 / + [in contig]
Location194452..195213 [in whole cluster]
194452..195213 [in contig]
TypeCDS
Length762 bp (253 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)thioesterase
GenesalGII
Gene (GenBank)salGI
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Related Reference
ACC
H6D589
NITE
Salino3_00330
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)
ACC
Q846W2
NITE
Monen_00290
PmId
[16984884] Identification of NanE as the thioesterase for polyether chain release in nanchangmycin biosynthesis. (Chem Biol. , 2006)

close this sectionSequence

selected fasta
>putative type II thioesterase [thioesterase]
MVRHPWDVQAPDAPVRLFCLPWAGGSAVFYQRAWQREFAPDVDVRPLELPGRGIESDEKL
LRRVDDLVDFLLDRLTPLLDRPYALFGHSMGALLSLELTRRLAAEGYPAPVRLFQSGSGI
PGRRHRTTGRALHTLPENEFREWLRTTGGTPAAVFQNPELLDHLSPLLRADFELCDVYRE
RGGAPLSCPVTAIGGDADPYVPVEALSEWSEITTGPCELMVLSGGHFAFQDHLDRVRSYV
AAALRTATAGLTH
selected fasta
>putative type II thioesterase [thioesterase]
ATGGTCCGTCACCCCTGGGACGTTCAGGCGCCGGACGCACCCGTGCGGCTGTTCTGCCTT
CCGTGGGCCGGAGGCAGCGCCGTCTTCTACCAGCGGGCCTGGCAGAGAGAGTTCGCACCG
GACGTCGATGTGCGGCCCCTCGAACTCCCGGGCCGCGGCATCGAGTCGGACGAGAAGCTG
CTGCGCCGGGTCGACGACCTGGTCGACTTCCTCCTCGACCGCCTCACCCCGCTCCTGGAC
CGCCCCTACGCCCTCTTCGGCCACAGCATGGGCGCCCTGCTCAGCCTGGAACTCACCCGG
CGCCTGGCCGCCGAGGGCTACCCCGCGCCGGTCCGCCTCTTCCAGTCCGGCAGCGGCATC
CCCGGACGGCGGCACCGCACCACCGGCCGCGCCCTGCACACGCTGCCCGAGAACGAGTTC
CGGGAGTGGCTGCGCACCACCGGCGGGACGCCCGCGGCCGTCTTCCAGAACCCCGAACTC
CTCGACCACCTCTCGCCGTTGCTCCGCGCCGACTTCGAACTCTGCGATGTCTACCGGGAG
CGCGGCGGTGCCCCGCTGTCCTGCCCGGTGACCGCGATCGGCGGCGACGCCGACCCGTAC
GTCCCCGTCGAGGCGCTCTCCGAATGGAGCGAGATCACCACCGGGCCCTGCGAGTTGATG
GTGCTCTCCGGCGGCCACTTCGCCTTCCAGGACCACCTGGACCGCGTGCGGTCCTATGTC
GCCGCGGCGCTGCGGACCGCGACGGCCGGACTCACCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [16-241]  3.5e-41 PF00975
PF00975   Thioesterase
SignalP
 [1-27]  0.222 Signal
Eukaryota   
TMHMM No significant hit