close all open/close all

CDS information : Salino_01120


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction195,365 / 197,158 / + [in whole cluster]
195,365 / 197,158 / + [in contig]
Location195365..197158 [in whole cluster]
195365..197158 [in contig]
TypeCDS
Length1,794 bp (597 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)putative non-ribosomal peptide synthetase domains C, PCP
Gene
Gene (GenBank)salX
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Related Reference
ACC
H6D590
NITE
Salino3_00340
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [putative non-ribosomal peptide synthetase domains C, PCP]
MIPLSHAQNRLWPADRLGTGHEACHLPLVLRHSGPLDVRALRLALTDLVARHEILRTVFP
ERAGVPYQQILTEAPLPLPVEESGEERLTEDLRRVSAEPFDLRTGIPLRAHLFSLPGGSH
VLLVVLHRIAADEDSLSLLLTGLREAYAARREGAPPSWKPLPVQYADFALWQREVLGDLR
DPDSLLSRQLGEWSTALAGLPQRLTLPADRPGPARWESPAGCVRFKVGAALHRDLLDLGR
GSRATLFMVLHAALAALLTSLGAGEDIPVGSPVTGRADEVLEGVVGCFTNTLVIRSDTAD
KPSFRELLARVRERVLFAYAHGDVPFDLLAEEIAPASAAARAPLVQVLLSLRTERAQEPA
GEPEFTREEPARRTAPAELDLAFTQRRAGDGTPQGMTAVLTYAADRFDHPTAQSLAGELH
TLLRTAVREPLPPPGTEELLGPEQRGPFATAEAEQPGSRMRRSRRERLGHRREEVAAAPG
EGPGEDLCAAAAARARPPATPLESSLCRILAEVLAVEEVEPEDDFFELGGDSLLGMRVLS
RVRARLGIELGVCALFDAPTAAGLAEAFTRAEQDAADDDERGDEPPGRQPCGEGPRA
selected fasta
>non-ribosomal peptide synthetase [putative non-ribosomal peptide synthetase domains C, PCP]
GTGATCCCGCTGTCCCATGCCCAGAACCGGCTGTGGCCGGCTGACCGGCTGGGCACCGGC
CACGAGGCCTGCCATCTGCCGCTGGTGCTGCGGCACTCCGGCCCGCTCGACGTGCGCGCC
CTGCGCCTCGCGCTGACCGACCTCGTCGCCCGGCACGAGATCCTCCGCACCGTCTTCCCC
GAACGCGCCGGGGTGCCCTACCAGCAGATCCTCACCGAGGCCCCGCTCCCGCTGCCGGTC
GAGGAGAGCGGCGAGGAGCGGCTGACCGAGGACCTGCGGCGGGTGAGCGCCGAACCCTTC
GACCTGCGGACCGGCATCCCGCTGCGGGCCCACCTGTTCAGCCTCCCCGGCGGCAGCCAC
GTACTCCTGGTGGTGCTGCACCGCATCGCCGCCGACGAGGACTCCCTCTCCCTGCTGCTC
ACCGGGCTCCGCGAGGCGTACGCGGCCCGCCGCGAGGGCGCGCCGCCGTCCTGGAAGCCG
CTGCCGGTGCAGTACGCCGACTTCGCGCTGTGGCAGCGCGAGGTCCTCGGCGATCTGCGC
GACCCGGACAGCCTGCTCAGCCGTCAGCTCGGCGAGTGGAGCACGGCCCTCGCCGGGCTG
CCGCAGCGGCTCACCCTGCCCGCGGACCGGCCGGGGCCCGCCCGGTGGGAGAGCCCGGCG
GGCTGCGTGCGCTTCAAGGTCGGGGCCGCCCTGCACCGGGACCTCCTCGACCTGGGGCGC
GGCAGCCGGGCCACCCTCTTCATGGTGCTGCACGCAGCCCTGGCCGCCCTGCTGACCTCA
CTCGGCGCGGGCGAGGACATCCCGGTCGGCTCCCCCGTGACGGGCCGCGCCGACGAGGTC
CTCGAAGGGGTCGTCGGCTGCTTCACCAACACCCTGGTGATCCGCTCCGACACCGCCGAC
AAGCCGTCCTTCCGCGAACTGCTCGCCCGGGTCCGCGAACGCGTCCTGTTCGCCTACGCC
CACGGCGACGTCCCCTTCGACCTGCTCGCCGAGGAGATCGCCCCGGCCTCGGCCGCCGCC
CGCGCCCCGCTCGTCCAGGTCCTGCTGTCGCTGCGCACCGAACGCGCCCAGGAGCCCGCC
GGGGAACCGGAGTTCACCCGCGAGGAGCCCGCCCGCCGCACCGCCCCGGCCGAACTGGAC
CTCGCCTTCACCCAGCGCCGCGCCGGGGACGGCACCCCGCAGGGCATGACCGCGGTGCTC
ACCTACGCCGCCGACCGCTTCGACCACCCGACCGCCCAGTCCCTCGCGGGCGAGCTGCAC
ACCCTGCTGCGCACCGCCGTACGCGAGCCGCTCCCGCCGCCCGGCACCGAGGAGCTCCTC
GGCCCCGAGCAGCGCGGTCCCTTCGCCACCGCCGAGGCGGAGCAGCCCGGTTCACGGATG
CGCCGCAGCAGACGCGAGCGCCTCGGCCACCGCCGGGAGGAGGTCGCCGCGGCACCGGGG
GAGGGGCCCGGCGAGGACCTCTGCGCCGCGGCGGCGGCCCGGGCCAGGCCCCCGGCGACC
CCGCTGGAGTCGAGCCTGTGCCGGATCCTCGCCGAGGTGCTCGCCGTGGAGGAGGTGGAA
CCCGAGGACGACTTCTTCGAGCTGGGCGGGGACTCCCTGCTCGGCATGCGCGTCCTCAGC
CGGGTCCGCGCCCGGCTCGGCATCGAACTGGGCGTCTGCGCCCTCTTCGACGCCCCGACC
GCCGCCGGTCTCGCCGAGGCCTTCACCCGCGCCGAGCAGGACGCCGCCGACGACGACGAG
CGAGGCGACGAGCCGCCCGGACGGCAGCCGTGCGGGGAGGGCCCCCGCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001242 Condensation domain (Domain)
 [1-297]  2.80000000000001e-50 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [527-542]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [506-567]  7.90000000000001e-14 PF00550
PF00550   PP-binding
 [492-573]  8.19999999999997e-26 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [495-570]  3.39999972437717e-19 SSF47336
SSF47336   ACP_like
 [502-569]  PS50075
PS50075   ACP_DOMAIN
SignalP No significant hit
TMHMM No significant hit