close all open/close all

CDS information : Salino_01140


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction198,016 / 197,795 / - [in whole cluster]
198,016 / 197,795 / - [in contig]
Locationcomplement(197795..198016) [in whole cluster]
complement(197795..198016) [in contig]
TypeCDS
Length222 bp (73 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf5
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MPLDPMADIGRRAWLPCPNCDHGADCGTCGAGRSCTRHWQYLLSNKGPRVFLQCPDCTHL
WDTDPRGDGTRNH
selected fasta
>hypothetical protein [hypothetical protein]
ATGCCGCTCGACCCGATGGCGGACATCGGGCGCCGCGCCTGGCTGCCCTGCCCGAACTGC
GATCACGGCGCGGACTGCGGTACCTGCGGCGCGGGCCGCAGCTGCACCCGGCACTGGCAG
TACCTGCTGAGCAACAAGGGCCCGAGGGTCTTCCTCCAGTGCCCCGACTGCACCCACCTC
TGGGACACCGACCCGCGCGGAGACGGCACCCGGAACCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-13]  0.252 Signal
Bacteria, Gram-negative   
TMHMM No significant hit