close all open/close all
Salino_01150 Salino_01150   last last

CDS information : Salino_01160


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction199,166 / 198,441 / - [in whole cluster]
199,166 / 198,441 / - [in contig]
Locationcomplement(198441..199166) [in whole cluster]
complement(198441..199166) [in contig]
TypeCDS
Length726 bp (241 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator(fragment)
Product (GenBank)putative transcriptional activator
Gene
Gene (GenBank)salU
EC number
Keyword
  • SARP family
Note
Note (GenBank)
Reference
ACC
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Related Reference
ACC
H6D592
NITE
Salino3_00360
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)

close this sectionSequence

selected fasta
>putative transcriptional regulator(fragment) [putative transcriptional activator]
MLRAATGRLCDHLSARLAAAYRGGGPERAAHPDLVRLLERAHDLGLWAPVVRLAEALTPS
FEEQADWGPWREGHTRALDAARRAGDRRAEARLRRSLGDLAWQRRGHTAARAHYAAALAL
ARGVPDAEETGRCLAGLAELSLDAGGFTEAARLLDLALAASGDGGRGRYEARRVGALLAL
DRGRPEAAERHFAECLRLAAALGEPRLEAYARRCLAGVRDAPGSPGGLELRPGVWRLRPA
H
selected fasta
>putative transcriptional regulator(fragment) [putative transcriptional activator]
GTGCTGCGGGCCGCGACCGGTCGGCTCTGCGACCACCTGTCCGCCCGGCTGGCGGCGGCG
TACCGCGGCGGCGGCCCGGAGCGCGCCGCGCACCCGGATCTCGTACGGCTCCTGGAGCGG
GCCCATGACCTGGGGCTGTGGGCCCCGGTGGTGCGGCTCGCCGAGGCGCTCACCCCCTCC
TTCGAGGAGCAGGCCGACTGGGGGCCCTGGCGGGAGGGCCACACCCGCGCCCTGGACGCG
GCCCGGCGCGCGGGCGACCGCCGGGCCGAGGCGCGCCTGCGCCGCTCGCTGGGCGACCTG
GCCTGGCAGCGGCGGGGGCACACCGCAGCCCGCGCGCACTACGCGGCCGCCCTCGCGCTG
GCGCGCGGGGTCCCGGACGCCGAGGAGACCGGCCGCTGCCTCGCCGGGCTCGCCGAACTC
AGCCTGGACGCGGGCGGGTTCACCGAGGCGGCCCGGCTGCTCGACCTCGCGCTCGCGGCG
AGCGGGGACGGCGGGCGCGGCCGGTACGAGGCCCGGCGGGTGGGCGCGCTGCTGGCCCTG
GACCGCGGGCGGCCCGAGGCGGCCGAGCGGCATTTCGCGGAGTGCCTGCGGCTGGCCGCG
GCGCTCGGCGAGCCCCGCCTGGAGGCCTACGCCCGGCGCTGCCTGGCCGGGGTGCGCGAC
GCCCCCGGGAGCCCGGGCGGACTCGAACTGCGGCCCGGCGTCTGGCGGTTGCGCCCGGCC
CACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011990 Tetratricopeptide-like helical (Domain)
 [61-200]  1.2e-11 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
SignalP No significant hit
TMHMM No significant hit
Salino_01150 Salino_01150   last last