close all open/close all
first first   Sch475_00020 Sch475_00020

CDS information : Sch475_00010


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction498 / 1,481 / + [in whole cluster]
498 / 1,481 / + [in contig]
Location498..1481 [in whole cluster]
498..1481 [in contig]
TypeCDS
Length984 bp (327 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative transporter
Product (GenBank)putative transport system permease ABC transporter
Gene
Gene (GenBank)schA1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q93KC0
PmId
[11555291] Identification of TogMNAB, an ABC transporter which mediates the uptake of pectic oligomers in Erwinia chrysanthemi 3937. (Mol Microbiol. , 2001)
Family/Domain
FD
IPR000515

close this sectionSequence

selected fasta
>putative transporter [putative transport system permease ABC transporter]
MSMTTAKTDEVVKEQPAPSTPSDQRERDRMRRRLARRRGGGWWPYAFLAPWFIGLFGLTI
YPMLDSLYLSFTNFDLLTPAQWVGTDNYSKMFTDDPVFWDSVHATLLYVVVSVPLKLALA
LGVAMLLNRDLKGIGLYRAAFYLPSLLGGAVAIAIVWRQVFGGDGLFNDFLAWFGIKGQD
WISSPDTALYTLILLAVWQFGTPMVIFLAGLKQLPKDVYEAAAIDGASPVTRFFKITLPL
LTPIVFFNVVLQIIDAFKTFTPAFVISNGSGGPLNSTMLYSLYLYKKGFTDLQMGYASAL
AWVLFLVIAGFTAVNFIASRYWVHYDD
selected fasta
>putative transporter [putative transport system permease ABC transporter]
ATGAGTATGACCACCGCGAAGACAGACGAGGTCGTGAAGGAGCAGCCCGCTCCCTCGACC
CCGTCCGACCAGCGGGAGCGCGACCGTATGCGCCGCCGCCTCGCCAGACGGCGGGGCGGG
GGCTGGTGGCCGTACGCCTTCCTGGCCCCCTGGTTCATCGGCCTGTTCGGCCTGACGATC
TACCCGATGCTGGACTCGCTGTATCTGTCCTTCACCAACTTCGACCTGCTGACTCCGGCG
CAGTGGGTCGGGACCGACAACTACAGCAAGATGTTCACCGACGACCCGGTCTTCTGGGAC
TCGGTGCACGCCACGCTGCTGTACGTCGTCGTCTCGGTGCCGCTGAAGCTCGCGCTCGCG
CTCGGTGTGGCGATGCTGCTCAACCGCGACCTGAAGGGCATCGGTCTGTACCGGGCCGCC
TTCTATCTGCCGTCGCTGCTCGGCGGGGCGGTCGCCATCGCCATCGTGTGGCGGCAGGTC
TTCGGCGGCGACGGCCTGTTCAACGACTTCCTCGCCTGGTTCGGCATCAAGGGCCAGGAC
TGGATCTCCAGCCCCGACACCGCGCTCTACACGCTGATCCTGCTGGCCGTCTGGCAGTTC
GGCACCCCGATGGTCATCTTCCTCGCGGGTCTGAAGCAGCTGCCGAAGGATGTGTACGAG
GCCGCCGCGATCGACGGCGCCTCGCCGGTCACCCGGTTCTTCAAGATCACCCTGCCGCTG
CTGACCCCGATCGTCTTCTTCAACGTGGTCCTGCAGATCATCGACGCGTTCAAGACGTTC
ACCCCCGCCTTCGTCATCAGCAACGGCTCCGGCGGACCGCTCAACTCGACGATGCTGTAC
TCCCTCTACCTGTACAAAAAGGGCTTCACCGACCTCCAGATGGGATACGCCTCGGCTCTC
GCCTGGGTGCTGTTCCTGGTCATCGCTGGCTTCACGGCGGTCAACTTCATCGCCAGCCGC
TACTGGGTCCACTACGACGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000515 Binding-protein-dependent transport systems inner membrane component (Family)
 [102-315]  PS50928
PS50928   ABC_TM1
 [135-309]  8.1e-13 PF00528
PF00528   BPD_transp_1
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [39-61]  Transmembrane (i-o) [105-127]  Transmembrane (o-i) [139-161]  Transmembrane (i-o) [189-211]  Transmembrane (o-i) [232-254]  Transmembrane (i-o) [296-318]  Transmembrane (o-i)
Transmembrane 6   
first first   Sch475_00020 Sch475_00020