close all open/close all

CDS information : Sch475_00020


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction1,515 / 2,402 / + [in whole cluster]
1,515 / 2,402 / + [in contig]
Location1515..2402 [in whole cluster]
1515..2402 [in contig]
TypeCDS
Length888 bp (295 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative transporter
Product (GenBank)putative Oligogalacturonate transport system permease protein
Gene
Gene (GenBank)schA2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q93KB9
PmId
[11555291] Identification of TogMNAB, an ABC transporter which mediates the uptake of pectic oligomers in Erwinia chrysanthemi 3937. (Mol Microbiol. , 2001)
Family/Domain
FD
IPR000515

close this sectionSequence

selected fasta
>putative transporter [putative Oligogalacturonate transport system permease protein]
MSAITSAHAPKSPLQKLRSATGSRRIFIHTVLIGVAIVMLYPLLWMLSSSFKPDTHIFTQ
PGLIPSSVRPENYSEGWSGSGNSFSLYITNSLIVTIGAVIGNVISCSLAAYAFARFEFRG
KKIWFGLMLGTLMLPTQAVLIPQYTIFYNLTWINTYLPLIVPKFLAVDAFFIFLMVQFIR
SIPRELDHAAMMDGANPFQIYWKIILPLMKPALITTTIFTFIWTYDDFLHQLVYLQQNDK
FTVPLGLTLFMDQTSGSSYGAMFAMSTLALLPTLICFLIFQKRLVEGLATSGMKG
selected fasta
>putative transporter [putative Oligogalacturonate transport system permease protein]
ATGTCCGCCATCACCTCGGCCCACGCCCCGAAGTCGCCGTTGCAGAAGCTGCGTTCGGCC
ACCGGATCGCGCCGCATCTTCATCCACACCGTGCTCATCGGCGTGGCGATCGTCATGCTC
TATCCGCTGCTGTGGATGCTGAGCAGCTCGTTCAAGCCCGACACCCATATCTTCACCCAG
CCGGGGCTCATCCCGAGCTCGGTGCGCCCGGAGAACTACTCCGAGGGCTGGAGCGGCTCG
GGCAACTCCTTCTCCCTCTACATCACCAACTCGCTGATCGTCACGATCGGCGCGGTGATC
GGGAACGTGATCTCCTGCTCGCTGGCCGCCTACGCCTTCGCGCGCTTCGAGTTCCGCGGC
AAGAAGATCTGGTTCGGCCTGATGCTCGGCACGCTGATGCTGCCCACCCAGGCCGTGCTG
ATCCCGCAGTACACGATCTTCTACAACCTGACCTGGATCAACACCTATCTGCCGCTGATC
GTGCCGAAGTTCCTCGCGGTGGACGCCTTCTTCATCTTCCTGATGGTCCAGTTCATCCGC
TCCATCCCGCGCGAGCTCGACCACGCGGCGATGATGGACGGCGCCAACCCCTTCCAGATC
TACTGGAAGATCATCCTGCCGCTGATGAAGCCGGCCCTGATCACCACCACGATCTTCACC
TTCATCTGGACGTACGACGACTTCCTCCACCAGCTCGTCTACCTCCAGCAGAACGACAAG
TTCACCGTCCCCCTCGGCCTGACCCTGTTCATGGACCAGACGAGCGGCTCCTCCTACGGT
GCGATGTTCGCCATGTCGACTCTTGCCCTCCTGCCCACGCTCATCTGCTTCCTCATCTTC
CAGAAGAGGCTGGTAGAAGGCTTGGCGACCTCGGGCATGAAGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000515 Binding-protein-dependent transport systems inner membrane component (Family)
 [109-285]  1.8e-19 PF00528
PF00528   BPD_transp_1
 [88-280]  PS50928
PS50928   ABC_TM1
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [26-48]  Transmembrane (i-o) [91-113]  Transmembrane (o-i) [125-147]  Transmembrane (i-o) [157-179]  Transmembrane (o-i) [200-222]  Transmembrane (i-o) [258-280]  Transmembrane (o-i)
Transmembrane 6