close all open/close all

CDS information : Sch475_00025


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction2,408 / 4,249 / + [in whole cluster]
2,408 / 4,249 / + [in contig]
Location2408..4249 [in whole cluster]
2408..4249 [in contig]
TypeCDS
Length1,842 bp (613 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF was originally created by DoBISCUIT based on gene prediction.
Note (GenBank)

close this sectionSequence

selected fasta
>hypothetical protein
MHLPHQRGQLHHLPDDPAAYDAVLAAVTETALTRLTPEGNLENPAAVDDIGDTSLGITSL
LALAWHRTKDPRLPEAVRRSLAFHLNSRVYTEDNPGYPNLTARNSRLPYARYTLEAGAHP
IGDWPSTVWALLQAVNVLDAADGLVDDEQYRELLDVAGGYWRWLTEATFFNPQDAANQAI
GCVVGGLMLARHLPPEEGESVRRRALQLYADEIRARRVRDRGAPLPPEHGGAYDNNYGPI
SLSFLAQAHRVSGEEVFAEDGDTLARYIDARICASGFDIGGPRYSEQHSAFESVLGLRYF
GHRIGADIGRYAGDSRWARHAVGADGGVDGHFAYMLVWQIQDTTSWHRTPSTAPARHQLR
SGTVTVSFDDRMTPSVIEAGGTALVAAAVNRQHGFGPVTDDFLLCRPMGAVRVADVRADG
LAAKLVTKPVVGRDHVLRRLRSLYVTDGTRLWATVVVERLDGERYLLAGMPYVAADGDRF
RRVGDFPLVAAAGELRLTHPPEGSPDSFDARAEVTQQQAAFALAADPRGYGDPDAGWRHV
RTTSALEVGPVPDAPEGLDVFAVRYGEPAAEPLTVVCERVEEGLVLRTGSFTAVLGEADE
HGEPQLTLTPAGT
selected fasta
>hypothetical protein
GTGCATCTTCCCCACCAGCGCGGCCAGTTGCACCACCTCCCCGACGACCCGGCCGCGTAC
GACGCAGTGCTGGCCGCCGTCACCGAGACGGCCCTGACCCGCCTCACCCCCGAGGGCAAC
CTCGAGAACCCGGCCGCCGTCGACGACATCGGCGACACCTCGCTCGGCATCACGTCCCTG
CTCGCGCTCGCCTGGCACCGCACCAAGGACCCACGGCTGCCCGAAGCGGTCCGCCGCAGC
CTCGCCTTCCACCTGAACTCGCGCGTCTACACCGAGGACAACCCCGGCTACCCGAACCTG
ACGGCACGCAACTCCCGTCTGCCGTACGCCCGTTACACGCTGGAGGCAGGCGCGCACCCC
ATCGGCGACTGGCCGAGCACGGTGTGGGCGCTGCTCCAGGCCGTCAACGTCCTCGACGCG
GCGGACGGCCTCGTCGACGACGAGCAGTACCGCGAACTCCTGGACGTCGCGGGCGGTTAC
TGGCGCTGGCTCACCGAGGCCACCTTCTTCAACCCGCAGGACGCGGCGAACCAGGCCATC
GGCTGCGTGGTCGGCGGCCTGATGCTCGCCCGCCATCTCCCGCCCGAGGAGGGCGAGTCG
GTCCGGCGGCGTGCTCTGCAGCTGTACGCCGACGAGATCCGCGCCCGGCGTGTACGGGAC
CGGGGCGCGCCCCTGCCTCCGGAGCACGGCGGCGCCTACGACAACAACTACGGGCCCATC
TCCCTGTCCTTCCTCGCGCAGGCCCACCGGGTCAGCGGCGAGGAGGTCTTCGCGGAGGAC
GGCGACACGCTCGCCCGGTACATCGACGCGCGGATCTGCGCGAGCGGCTTCGACATCGGC
GGGCCGCGCTACAGCGAGCAGCACTCCGCCTTCGAATCCGTCCTCGGGCTGCGGTACTTC
GGCCATCGCATCGGCGCCGACATCGGTCGCTACGCCGGTGACTCGCGCTGGGCCCGGCAC
GCGGTCGGGGCCGACGGCGGCGTGGACGGGCACTTCGCGTACATGCTCGTCTGGCAGATC
CAGGACACCACGAGCTGGCACCGCACGCCGAGCACGGCGCCCGCCCGCCACCAGCTGCGG
TCCGGCACGGTCACCGTGTCGTTCGACGACCGGATGACGCCCTCCGTGATCGAGGCCGGC
GGCACGGCGCTCGTGGCCGCCGCCGTCAACCGGCAGCACGGGTTCGGGCCCGTGACGGAC
GACTTCCTGCTGTGCCGTCCGATGGGGGCGGTACGGGTGGCGGACGTGCGCGCCGACGGG
CTCGCGGCCAAGCTCGTGACCAAGCCCGTCGTCGGACGTGACCATGTCCTGCGCCGGCTT
CGGTCGCTGTACGTCACGGACGGCACGCGGCTGTGGGCCACCGTGGTCGTCGAACGGCTC
GACGGGGAGCGGTACTTGCTCGCCGGGATGCCGTATGTCGCCGCGGACGGTGACCGGTTC
CGCCGGGTGGGCGACTTCCCGCTCGTCGCCGCCGCCGGCGAGCTGCGCCTGACGCACCCC
CCGGAAGGCAGCCCGGACTCCTTCGACGCCCGCGCCGAAGTCACCCAGCAGCAGGCCGCG
TTCGCGTTGGCGGCCGATCCGCGTGGGTACGGGGACCCCGACGCCGGGTGGCGGCACGTG
CGGACCACGTCCGCGCTGGAGGTCGGGCCCGTGCCGGATGCGCCGGAGGGGCTCGACGTC
TTCGCGGTGCGGTACGGGGAACCGGCCGCCGAGCCGCTGACCGTGGTGTGCGAGCGGGTG
GAGGAGGGGCTGGTTCTGCGTACGGGCTCCTTCACCGCGGTGCTCGGCGAAGCCGACGAG
CATGGCGAGCCGCAGCTCACGTTGACTCCCGCGGGGACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit