close all open/close all

CDS information : Sch475_00030


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction5,939 / 4,587 / - [in whole cluster]
5,939 / 4,587 / - [in contig]
Locationcomplement(4587..5939) [in whole cluster]
complement(4587..5939) [in contig]
TypeCDS
Length1,353 bp (450 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative major facilitator superfamily transporter
Product (GenBank)putative 3-(2-hydroxyphenyl) propionic acid transporter
Gene
Gene (GenBank)schA3
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q45082
PmId
[8828207] 4-Methylphthalate catabolism in Burkholderia (Pseudomonas) cepacia Pc701: a gene encoding a phthalate-specific permease forms part of a novel gene cluster. (Microbiology. , 1996)
ACC
P76350
PmId
[9524262] Cloning and analysis of the shiA gene, which encodes the shikimate transport system of escherichia coli K-12. (Gene. , 1998)

close this sectionSequence

selected fasta
>putative major facilitator superfamily transporter [putative 3-(2-hydroxyphenyl) propionic acid transporter]
MSVPAAPLDAPPGQPKKAATAAWIGSALEYYDFFIYGSAAALIFPEVFFDESDPATATLL
SLATFGVAYAARPVGALFLGHFGDKVGRKKIMVFTLILMGLSTFLIGCLPTRDQVGTLAP
VLLVICRVLQGISAAGEQASANSMSLEHAPPNKRGFFTSFTLSGTQGGQLLATLVFIPVA
ALPEDQLLSWGWRVPFWMSIAVAVVGYVIRRTLEETPTFTQQAATEGVAKMPLAVLLRDH
WADVLRVVAAALVASVSTIFTVWALSYATSDSVGMDRTSMLWVGALANLVALGAIPLWAT
LSDRIGRRPVFLIGAAGSGVLMVAYLWAISTGSYPLVMVLGIVTFGVVYSAANGVWPSFY
GEMFSTRVRLSGMAIGTQIGFAIAGFAVTFAAQIAGPDGDDWASVALFTAALCVPPVIAA
LTARETHKVPTEHLGERAPQDSPNREPVSA
selected fasta
>putative major facilitator superfamily transporter [putative 3-(2-hydroxyphenyl) propionic acid transporter]
GTGTCCGTCCCCGCAGCGCCCCTCGACGCGCCACCCGGCCAGCCAAAGAAGGCTGCGACG
GCCGCCTGGATCGGCAGCGCGCTGGAGTACTACGACTTCTTCATCTACGGCAGCGCGGCG
GCGCTGATCTTCCCCGAGGTCTTCTTCGACGAGTCGGACCCGGCCACCGCGACCCTGCTG
TCGCTGGCCACGTTCGGCGTCGCGTACGCGGCCAGGCCGGTCGGCGCGCTGTTCCTCGGG
CACTTCGGCGACAAGGTCGGCCGCAAGAAGATCATGGTCTTCACGCTGATCCTGATGGGC
CTCTCGACGTTCCTCATCGGCTGTCTGCCGACGCGCGACCAGGTCGGCACGCTGGCCCCG
GTGCTCCTGGTGATCTGCCGTGTCCTGCAGGGCATCTCGGCCGCCGGCGAGCAGGCCAGC
GCCAACTCCATGTCACTGGAACACGCGCCACCCAACAAACGCGGCTTCTTCACCAGCTTC
ACGCTCAGCGGCACGCAGGGCGGCCAGCTCCTCGCCACGCTGGTGTTCATCCCGGTCGCC
GCGCTCCCCGAGGACCAACTCCTCTCCTGGGGCTGGCGGGTCCCGTTCTGGATGAGCATC
GCGGTCGCCGTCGTCGGCTACGTCATCCGCCGCACGCTGGAGGAGACCCCGACCTTCACC
CAGCAGGCCGCCACCGAGGGCGTCGCGAAGATGCCGCTCGCCGTGCTGCTGCGGGACCAC
TGGGCGGACGTCCTCAGGGTGGTCGCGGCCGCGCTCGTCGCCTCGGTCAGCACGATCTTC
ACGGTGTGGGCGCTGTCGTACGCCACCAGCGACTCCGTCGGCATGGACCGTACGTCCATG
CTGTGGGTGGGTGCGCTCGCCAACCTGGTCGCCCTGGGCGCCATCCCCCTCTGGGCAACC
CTCTCCGACCGCATCGGCCGCCGGCCCGTCTTCCTGATCGGCGCCGCGGGCAGTGGCGTG
CTGATGGTCGCCTACCTGTGGGCCATCTCCACGGGCTCCTACCCGCTGGTCATGGTCCTC
GGCATCGTCACCTTCGGTGTCGTCTACAGCGCCGCGAACGGTGTCTGGCCGTCCTTCTAC
GGCGAGATGTTCTCCACTCGGGTCCGCCTCTCGGGCATGGCCATCGGCACGCAGATCGGC
TTCGCCATCGCCGGGTTCGCGGTGACCTTCGCCGCGCAGATCGCGGGTCCGGACGGGGAC
GACTGGGCGTCGGTGGCGCTGTTCACCGCGGCGCTGTGCGTCCCGCCGGTGATCGCGGCG
CTCACGGCCCGCGAAACCCACAAGGTCCCGACGGAACACCTCGGCGAGCGGGCACCCCAG
GACTCCCCGAACCGAGAGCCGGTCTCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005828 General substrate transporter (Family)
 [20-225]  6.8e-28 PF00083 [247-433]  3.5e-14 PF00083
PF00083   Sugar_tr
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-439]  1.2e-65 SSF103473
SSF103473   MFS general substrate transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [18-428]  32.518 PS50850
PS50850   MFS
SignalP
 [1-21]  0.287 Signal
Bacteria, Gram-positive   
TMHMM
 [21-43]  Transmembrane (i-o) [58-80]  Transmembrane (o-i) [92-111]  Transmembrane (i-o) [190-209]  Transmembrane (o-i) [244-265]  Transmembrane (i-o) [280-302]  Transmembrane (o-i) [309-331]  Transmembrane (i-o) [335-357]  Transmembrane (o-i) [370-392]  Transmembrane (i-o) [402-421]  Transmembrane (o-i)
Transmembrane 10