close all open/close all

CDS information : Sch475_00040


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction6,883 / 6,218 / - [in whole cluster]
6,883 / 6,218 / - [in contig]
Locationcomplement(6218..6883) [in whole cluster]
complement(6218..6883) [in contig]
TypeCDS
Length666 bp (221 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)putative TetR family transcriptional regulator
Gene
Gene (GenBank)schA4
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Family/Domain
FD
IPR001647

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [putative TetR family transcriptional regulator]
MTSVEEPARPNGRIRDAARTQAEILDVATHEFARAGYDGARVDEIAARTRTTKRMIYYYF
GGKDQLFTAVLERAYSVIREAEQGLDVEHLDPVAAIRRLAELTFDHHEAHPDFIRLVSIE
NIHGAEHVAASEKLGKIGSPALDVIRRILESGQESGLFTADVDAVDLHAMISSFCFFRVA
NRHTFGALFGRDLVDPAQREHYRNMLGDMVIAYLTADRSAD
selected fasta
>putative TetR family transcriptional regulator [putative TetR family transcriptional regulator]
ATGACCAGCGTCGAAGAACCGGCACGACCGAACGGGCGCATCCGTGACGCGGCCCGCACC
CAGGCCGAGATCCTCGACGTCGCCACGCACGAGTTCGCCCGGGCCGGCTACGACGGGGCC
AGGGTCGACGAGATCGCCGCCCGCACCCGGACCACGAAGCGGATGATCTATTACTACTTC
GGCGGCAAGGACCAGCTGTTCACCGCGGTACTGGAGCGGGCGTACAGCGTCATCCGCGAG
GCCGAGCAGGGGCTCGACGTGGAGCACCTGGACCCGGTCGCGGCCATCCGGCGGCTGGCC
GAGCTGACCTTCGACCACCACGAGGCGCACCCCGACTTCATCCGCCTGGTCAGCATCGAG
AACATCCACGGTGCCGAGCACGTCGCCGCCTCCGAGAAGCTCGGCAAGATCGGCTCGCCC
GCCCTGGACGTGATCCGCCGCATCCTGGAGTCGGGGCAGGAGTCGGGCCTCTTCACCGCC
GACGTGGACGCCGTCGACCTGCACGCGATGATCAGCTCGTTCTGCTTCTTCCGGGTCGCC
AACCGGCACACCTTCGGGGCCCTGTTCGGCCGCGACCTGGTCGACCCGGCCCAGCGCGAG
CACTACCGGAACATGCTGGGCGACATGGTCATCGCCTATCTGACGGCGGACCGCTCGGCG
GACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [18-78]  PS50977
PS50977   HTH_TETR_2
 [24-70]  4.3e-14 PF00440
PF00440   TetR_N
 [24-37]  8.70000305989074e-06 PR00455 [45-68]  8.70000305989074e-06 PR00455
PR00455   HTHTETR
IPR009057 Homeodomain-like (Domain)
 [8-96]  1.99999636034521e-19 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [90-217]  1.60000240695997e-39 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [9-215]  2.4e-39 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP No significant hit
TMHMM No significant hit