close all open/close all

CDS information : Sch475_00050


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction7,072 / 7,965 / + [in whole cluster]
7,072 / 7,965 / + [in contig]
Location7072..7965 [in whole cluster]
7072..7965 [in contig]
TypeCDS
Length894 bp (297 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative quinate/shikimate dehydrogenase
putative NAD(+)-dependent quinate dehydrogenase
Product (GenBank)putative shikimate 5-dehydrogenase
Gene
Gene (GenBank)schA5
EC number1.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q9X5C9
PmId
[18566515] 1.6 angstroms structure of an NAD+-dependent quinate dehydrogenase from Corynebacterium glutamicum. (Acta Crystallogr D Biol Crystallogr. , 2008)

close this sectionSequence

selected fasta
>putative quinate/shikimate dehydrogenase [putative shikimate 5-dehydrogenase]
MVKDSYLVGLIGAGIGPSLSPALHEREADRQGLRYLYRLIDIDALGVGPQAVGDLVRAAR
DLGFDGLNITHPCKQLVIGHLDALAPQAEALGAVNTVVFEGGRAVGHNTDVTGFAASFAR
GLPDAPLERVVQLGAGGAGAAVAHAMLTLGAGHVTVVDAMPDRSADLAASLNRHFGAGRA
AAAGPERLAALLGGADGIVHATPTGMAAHPGLPLPGELLHPGLWVAEVVYRPLETELLRA
ARAAGCAVLDGGGMAVFQAADAFRLFTGREPDAVRMLADIAELAGVAGAAGAAGARS
selected fasta
>putative quinate/shikimate dehydrogenase [putative shikimate 5-dehydrogenase]
ATGGTCAAGGACTCGTATCTCGTCGGGCTGATCGGCGCCGGGATCGGCCCGTCGCTCAGC
CCGGCACTGCACGAGCGGGAGGCCGACCGGCAGGGCCTGCGCTATCTGTACCGGCTGATC
GACATCGACGCGCTCGGTGTCGGGCCGCAGGCGGTGGGGGACCTCGTACGAGCCGCCCGC
GACCTGGGCTTCGACGGGCTGAACATCACGCATCCCTGCAAGCAGCTCGTCATCGGGCAT
CTGGACGCGCTCGCCCCGCAGGCCGAGGCGCTCGGCGCGGTGAACACCGTCGTCTTCGAG
GGCGGGCGTGCGGTCGGGCACAACACCGATGTCACCGGGTTCGCCGCCTCGTTCGCCCGT
GGGCTGCCGGATGCCCCGCTGGAGCGGGTCGTGCAGTTGGGCGCGGGGGGAGCGGGGGCG
GCCGTCGCGCATGCCATGCTCACGCTCGGGGCCGGGCACGTCACCGTCGTCGATGCCATG
CCGGACCGGTCGGCGGACCTCGCCGCCTCGCTGAACCGGCACTTCGGTGCGGGGCGGGCC
GCTGCCGCGGGCCCGGAGCGGCTGGCGGCGCTGCTCGGCGGTGCGGACGGCATCGTGCAT
GCCACGCCGACGGGGATGGCCGCTCATCCGGGGCTGCCGCTTCCCGGTGAGTTGCTGCAT
CCCGGGTTGTGGGTGGCCGAGGTGGTGTACCGGCCGTTGGAGACCGAGTTGCTGCGTGCC
GCTCGGGCGGCGGGGTGTGCGGTTCTCGATGGTGGGGGGATGGCTGTTTTCCAGGCCGCG
GACGCGTTTCGGCTGTTCACGGGGCGGGAGCCGGACGCGGTGCGGATGCTTGCGGATATT
GCGGAGTTGGCCGGTGTGGCCGGTGCCGCAGGCGCCGCCGGGGCGCGGAGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013708 Shikimate dehydrogenase substrate binding, N-terminal (Domain)
 [10-97]  5.5e-22 PF08501
PF08501   Shikimate_dh_N
IPR016040 NAD(P)-binding domain (Domain)
 [115-279]  5.69999999999998e-43 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit