close all open/close all

CDS information : Sch475_00060


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction8,041 / 9,921 / + [in whole cluster]
8,041 / 9,921 / + [in contig]
Location8041..9921 [in whole cluster]
8041..9921 [in contig]
TypeCDS
Length1,881 bp (626 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative 4-hydroxyphenyl pyruvate dioxygenase
Gene
Gene (GenBank)schA6
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [putative 4-hydroxyphenyl pyruvate dioxygenase]
MQGLSRVVKWNRRSINVRTSIATVSLSGALTEKLTAAARAGFDGVEIFENDLLASPLTPE
EVRARCADLGLSIDLYQPMRDIEAVPAEGFGRNLRRAEHKFRLMERLGADTVLVCSSVSP
LAEDDDALAAFQLRRLAELAEGFGIRVAYEALAWGRHVSTYDHAWRIVEAADHPALGTCL
DSFHILARGSDPKGIEDIPGEKIFFLQLADAPLMAMDVLQWSRHYRCFPGQGGFDVAGLV
GHVMRAGYEGPLSLEVFNDVFRQAEAGPTAVDALRSLLVLQESVGLTALPAPAVPTGVAF
AELITPDVEPLSEILEALGFARTARHRSKPVDLWQQGEARLLLNTGPAARRDGTQLAAVG
LESPDPAGAARRAEALLAPVLPRRRAPEDAPLDAVAAPDGTELFFCATDRPELPSWTGDF
EPTAHKSPVVHTSLVAHESPVAGGIHRIDHLALTQPWHQFDEAALFHHSVLGLGAQESVD
VADPYGLLRSRAVTNADGSVRIALGVGAAPSADEGGRAQHIALATGDIVTAARRFRDAGG
RLLPIPANYYDDLAAKYELGDGELEAYRELGILYDREADGAFRHCYTETIGRVFFELVQR
DAGYRGYGAQNAPVRLAAQHVRRPVR
selected fasta
>hypothetical protein [putative 4-hydroxyphenyl pyruvate dioxygenase]
ATGCAGGGCCTCAGCCGTGTCGTGAAGTGGAACCGGAGGAGCATCAACGTGCGTACGTCC
ATTGCCACCGTCTCTCTCAGTGGGGCCCTTACCGAGAAGCTCACGGCCGCGGCGCGGGCG
GGCTTCGACGGTGTCGAGATCTTCGAGAACGACCTGCTCGCCAGCCCCCTCACGCCCGAG
GAGGTGCGGGCCCGCTGTGCCGATCTCGGGCTGAGCATCGACCTCTACCAGCCGATGCGT
GACATCGAGGCGGTGCCGGCGGAGGGGTTCGGGCGGAATCTGCGGCGGGCCGAGCACAAG
TTCCGGCTGATGGAGCGGCTCGGGGCCGACACCGTGCTCGTGTGCTCCAGCGTGTCGCCG
CTCGCCGAGGACGACGACGCGCTGGCCGCGTTCCAGCTGCGGCGGCTCGCCGAACTGGCC
GAGGGGTTCGGCATCCGCGTCGCGTACGAGGCGTTGGCGTGGGGGCGGCACGTCAGTACG
TACGACCATGCCTGGCGCATCGTCGAGGCGGCCGACCATCCCGCGCTCGGGACGTGCCTG
GACAGTTTTCACATCCTGGCCCGCGGTTCCGATCCCAAGGGGATCGAGGACATTCCCGGC
GAGAAGATCTTCTTCCTGCAGCTGGCCGACGCGCCGCTGATGGCGATGGACGTGCTGCAG
TGGAGCCGGCACTACCGCTGCTTCCCCGGGCAGGGCGGCTTCGATGTCGCCGGGCTCGTC
GGGCATGTGATGCGTGCCGGATACGAAGGGCCGCTCTCGCTGGAGGTGTTCAACGACGTG
TTCCGGCAGGCGGAGGCCGGGCCGACCGCTGTCGACGCGTTGCGTTCGCTGCTCGTGCTG
CAGGAGAGCGTCGGCCTCACCGCGCTGCCCGCTCCTGCCGTACCGACCGGTGTCGCCTTC
GCGGAACTGATCACCCCCGATGTCGAACCGCTGTCGGAGATCCTCGAAGCGCTCGGCTTC
GCCCGCACGGCCCGGCACCGCAGCAAGCCGGTCGACCTGTGGCAGCAGGGTGAGGCCCGG
CTGCTGCTCAACACGGGTCCGGCCGCACGACGGGACGGTACCCAGCTGGCCGCCGTCGGT
CTGGAGTCCCCGGATCCGGCGGGCGCGGCCCGGCGGGCCGAGGCGCTGCTCGCTCCTGTG
CTGCCGCGCCGGCGCGCCCCCGAGGACGCCCCGCTGGACGCGGTCGCCGCACCCGACGGC
ACGGAACTCTTCTTCTGCGCCACGGACCGACCCGAACTGCCCAGCTGGACCGGCGACTTC
GAGCCCACCGCGCACAAGTCGCCCGTCGTGCACACGTCGCTTGTCGCGCACGAGTCGCCC
GTCGCCGGGGGCATACACCGCATCGACCATCTGGCCCTCACCCAGCCCTGGCACCAGTTC
GACGAGGCGGCCCTCTTCCACCACAGCGTCCTCGGACTCGGCGCGCAGGAGAGCGTGGAC
GTCGCCGACCCGTACGGGCTGTTGCGCAGCCGTGCCGTCACCAACGCCGACGGCAGTGTG
CGGATCGCCCTCGGTGTCGGAGCGGCCCCGAGCGCCGACGAGGGCGGCCGGGCCCAGCAC
ATCGCCCTCGCGACCGGCGACATCGTCACTGCGGCCCGCCGGTTCCGGGACGCCGGAGGC
CGCCTCCTGCCCATCCCCGCGAACTACTACGACGACCTCGCGGCCAAGTACGAGTTGGGT
GACGGCGAGCTGGAGGCGTACCGCGAACTCGGCATCCTCTACGACCGGGAGGCGGACGGC
GCCTTCCGGCACTGCTACACGGAGACGATCGGCCGCGTCTTCTTCGAGCTGGTCCAGCGT
GACGCTGGCTACCGCGGCTACGGCGCGCAGAACGCCCCGGTGCGGCTCGCCGCCCAGCAC
GTACGGCGGCCGGTGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004360 Glyoxalase/fosfomycin resistance/dioxygenase domain (Domain)
 [448-555]  1.6e-06 PF00903
PF00903   Glyoxalase
IPR012307 Xylose isomerase, TIM barrel domain (Domain)
 [34-233]  2.70000000000002e-33 PF01261
PF01261   AP_endonuc_2
IPR013022 Xylose isomerase-like, TIM barrel domain (Domain)
 [18-278]  5.99999999999995e-77 G3DSA:3.20.20.150
G3DSA:3.20.20.150   Xyl_isomerase-like_TIM-brl
 [15-291]  3.30001976117415e-77 SSF51658
SSF51658   Xyl_isomerase-like_TIM-brl
SignalP
 [1-38]  0.955 Signal
Bacteria, Gram-positive   
 [1-31]  0.55 Signal
Eukaryota   
 [1-36]  0.554 Signal
Bacteria, Gram-negative   
TMHMM No significant hit