close all open/close all

CDS information : Sch475_00070


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction10,223 / 11,704 / + [in whole cluster]
10,223 / 11,704 / + [in contig]
Location10223..11704 [in whole cluster]
10223..11704 [in contig]
TypeCDS
Length1,482 bp (493 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative amino acid transporter
Product (GenBank)probable amino acid transporter transmembrane protein s
Gene
Gene (GenBank)schA7
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Family/Domain
FD
IPR002293

close this sectionSequence

selected fasta
>putative amino acid transporter [probable amino acid transporter transmembrane protein s]
MGNNRGRGLQANVLGTFDTVVMAIAGSAPAYSLAATTAVLVGAVGLASPAALLYCAIPML
GIALAFSYLSRIDTNAGASYSWVGRTLHPFLGFISGWALVVSATIFMVAGSLPAGSMTLS
LFDEGLADNTALSTLVGAAWFVAMLLVVLGGARLTVRAQLIMSGVELAILALFAVGAVLH
TDNARPFDWSWLGFSHFDGVSGFASGALIAAFYYWGWDVTSNLSEETKDSRRTTGLAGLI
GVGIVFLLFEAFTIAVNVILTSQQIQDNDANVLAVLGEEIWPGWGGKLLIVSVMLSTIAT
LETTLIQVTRSLFAMGRDHTMPSALGKVHRTWNTPYVAITVVGAVALLMLVASNALGSVG
DILENAIAAIGLQIAVYYGLAGLAVVVAYRKMLLKSPSNFLFGGLWPFLGALFMFWIFIE
SLSDLSNASIAIGIGGLAVGLVPMLWYWLQGSDYYRPADLDASDVVETDYIPDGYTAAEA
ERSRVHEGLPTDF
selected fasta
>putative amino acid transporter [probable amino acid transporter transmembrane protein s]
ATGGGCAACAACAGGGGCAGAGGGCTCCAGGCCAATGTCCTCGGCACGTTCGACACGGTC
GTGATGGCGATCGCCGGCAGCGCCCCGGCGTACTCGCTCGCCGCGACCACCGCGGTTCTC
GTCGGCGCGGTGGGTCTGGCCAGCCCCGCGGCGCTGCTGTACTGCGCGATACCCATGCTG
GGCATAGCCCTGGCCTTCAGCTATCTCAGCCGGATCGACACCAACGCGGGCGCCAGCTAC
TCCTGGGTCGGCCGCACGCTCCACCCCTTCCTCGGCTTCATCAGCGGCTGGGCGCTGGTC
GTCTCGGCCACCATCTTCATGGTCGCCGGTTCGCTGCCCGCCGGTTCGATGACGCTGTCC
CTCTTCGACGAGGGGCTCGCGGACAACACGGCCCTGTCCACCCTGGTCGGCGCGGCCTGG
TTCGTCGCCATGCTGCTGGTTGTGCTGGGCGGCGCCCGGCTCACCGTCCGCGCGCAGCTG
ATCATGTCCGGTGTCGAGCTCGCCATCCTGGCCCTCTTCGCCGTCGGCGCCGTGCTCCAC
ACCGACAATGCCCGGCCCTTCGACTGGTCCTGGCTCGGCTTCAGCCACTTCGACGGGGTG
AGCGGCTTCGCGTCCGGCGCGCTCATCGCCGCCTTCTACTACTGGGGCTGGGACGTCACC
TCCAACCTCAGCGAGGAGACCAAGGACAGCCGGCGCACCACGGGCCTCGCGGGCCTGATC
GGCGTGGGCATCGTCTTCCTCCTCTTCGAGGCCTTCACCATCGCGGTGAACGTCATCCTC
ACTTCGCAGCAGATCCAGGACAACGACGCCAACGTCCTCGCGGTGCTCGGTGAGGAGATC
TGGCCGGGCTGGGGCGGCAAGCTGCTGATCGTCTCCGTGATGCTGTCCACCATCGCCACC
CTGGAGACCACGCTCATCCAGGTCACGCGTTCCCTGTTCGCGATGGGCCGCGACCACACG
ATGCCCAGCGCCCTGGGCAAGGTCCACCGCACGTGGAACACCCCGTACGTCGCCATCACC
GTGGTCGGCGCGGTCGCACTGCTGATGCTCGTGGCCTCCAACGCCCTCGGCAGCGTCGGC
GACATCCTGGAGAACGCCATCGCCGCGATCGGCCTCCAGATCGCCGTGTACTACGGCCTC
GCGGGGCTCGCGGTCGTCGTCGCCTATCGCAAGATGCTGCTGAAGTCGCCGTCCAACTTC
CTCTTCGGCGGGCTGTGGCCGTTCCTCGGCGCCCTGTTCATGTTCTGGATCTTCATCGAG
TCACTGAGCGATCTGAGCAACGCCTCGATCGCCATCGGCATCGGGGGCCTGGCCGTCGGA
CTCGTCCCCATGCTCTGGTACTGGCTCCAGGGCAGCGACTACTACCGGCCGGCGGACCTG
GACGCCAGCGACGTCGTCGAGACGGACTACATACCCGACGGCTACACCGCCGCCGAGGCG
GAACGTTCCCGCGTCCACGAGGGTCTCCCCACCGACTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002293 Amino acid/polyamine transporter I (Family)
 [7-466]  2.80000504261099e-67 PIRSF006060
PIRSF006060   AA_transporter
SignalP
 [1-55]  0.224 Signal
Eukaryota   
 [1-34]  0.777 Signal
Bacteria, Gram-negative   
 [1-34]  0.644 Signal
Bacteria, Gram-positive   
TMHMM
 [13-35]  Transmembrane (i-o) [50-69]  Transmembrane (o-i) [90-112]  Transmembrane (i-o) [132-154]  Transmembrane (o-i) [161-180]  Transmembrane (i-o) [195-217]  Transmembrane (o-i) [238-260]  Transmembrane (i-o) [291-313]  Transmembrane (o-i) [334-356]  Transmembrane (i-o) [366-388]  Transmembrane (o-i) [400-419]  Transmembrane (i-o) [429-449]  Transmembrane (o-i)
Transmembrane 12