close all open/close all

CDS information : Sch475_00080


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction11,716 / 12,678 / + [in whole cluster]
11,716 / 12,678 / + [in contig]
Location11716..12678 [in whole cluster]
11716..12678 [in contig]
TypeCDS
Length963 bp (320 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
GeneschA8
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • chA8
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MARDRFKPEFDPDCGDAPLTSAKQDIVIGRWQGLRDLLRTTGPVWLARGHRMRLLAQACA
STSTAESWLAAEPHSGDALVLRAATETARAFNLAIAAGRGVPIDLNRVDGAVMACLQAAE
AYVDDPTPWISLIAVARLYPTGVRRQELGRWWDELHARDPYSVEGHLQVLHYYSARWHGT
HGVMYDFARDAAGVAPPGCALPVLVQFARVEEYRYILEGAKGQQGSLTGVSQHWNHDGAV
SDVRRTWQRWITGRPDAPVEPGEIHQLNHLTHAACHAGVPDITASLFRLLGRRATRTPWS
YTGDPEKQITRWHNNPKHRA
selected fasta
>hypothetical protein [hypothetical protein]
ATGGCGAGAGACCGCTTCAAGCCCGAGTTCGACCCCGACTGCGGGGACGCGCCCCTCACC
TCCGCCAAACAGGACATCGTCATCGGCCGCTGGCAGGGGCTGCGGGATCTGCTGCGGACC
ACCGGCCCCGTGTGGCTTGCGAGGGGCCACCGGATGCGGCTGCTCGCGCAGGCCTGCGCG
AGCACCTCGACGGCCGAGTCCTGGCTGGCCGCTGAGCCCCACAGCGGTGACGCGCTGGTG
CTGCGGGCCGCGACCGAGACGGCACGGGCCTTCAACCTGGCCATCGCCGCGGGCCGGGGT
GTCCCCATCGACCTGAACCGCGTCGACGGCGCGGTCATGGCCTGCCTCCAGGCCGCCGAG
GCGTACGTCGACGACCCCACTCCCTGGATCTCGCTCATCGCCGTCGCGCGGCTCTATCCC
ACCGGGGTGCGGCGCCAGGAACTGGGACGCTGGTGGGACGAGCTGCACGCCCGCGACCCC
TACAGCGTGGAGGGCCATCTCCAGGTGCTGCACTACTACTCGGCGCGCTGGCACGGTACC
CACGGCGTGATGTACGACTTCGCCCGGGACGCGGCCGGGGTGGCTCCGCCGGGGTGTGCG
CTGCCGGTGCTCGTGCAGTTCGCCCGGGTGGAGGAGTACCGGTACATCCTGGAAGGGGCG
AAGGGGCAGCAGGGGTCTCTGACCGGGGTCAGTCAGCACTGGAATCATGACGGGGCCGTC
AGTGATGTGCGGCGTACCTGGCAGCGGTGGATCACGGGCCGTCCCGACGCGCCCGTCGAG
CCGGGGGAAATCCACCAGCTCAACCACCTCACGCACGCCGCCTGTCACGCCGGGGTGCCG
GACATCACCGCCTCACTGTTCCGCCTCCTCGGCCGACGGGCCACGCGGACGCCGTGGTCG
TACACGGGTGACCCCGAGAAACAAATCACGAGATGGCACAACAACCCGAAGCACCGTGCG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit