close all open/close all

CDS information : Sch475_00090


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction13,670 / 13,077 / - [in whole cluster]
13,670 / 13,077 / - [in contig]
Locationcomplement(13077..13670) [in whole cluster]
complement(13077..13670) [in contig]
TypeCDS
Length594 bp (197 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Producthistidine phosphatase family protein
Product (GenBank)putative phosphate mutase
Gene
Gene (GenBank)schA9
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Family/Domain
FD
IPR013078

close this sectionSequence

selected fasta
>histidine phosphatase family protein [putative phosphate mutase]
MGDLLLVRHGETEWSRSGRHTSWTDLPLTQRGEEQAKSLVPLFAGRHFALVLSSPLGRAI
RTAELAGLTGAVSDPDMHEWDYGAYEGIATVDIHRTRPDWYLWNDGVPAGSDGHPGESAD
EVGARADRVLARAEKSLGDGDVVLVAHAHFLRVLTARRLGLPAADGRLFRLGTGTLSRLS
LEHDRPVVSEWNTLPPG
selected fasta
>histidine phosphatase family protein [putative phosphate mutase]
ATGGGCGACCTCCTTCTCGTCCGGCACGGCGAGACCGAGTGGAGCAGGTCGGGCCGGCAC
ACCAGCTGGACCGATCTGCCCCTCACCCAGCGCGGTGAGGAACAGGCCAAGTCCCTCGTC
CCGCTGTTCGCCGGGCGGCACTTCGCGCTCGTACTCTCCAGTCCGCTCGGGCGGGCGATA
CGGACCGCGGAGCTGGCGGGGCTGACCGGGGCGGTGTCCGATCCGGACATGCACGAGTGG
GACTACGGGGCGTACGAAGGTATCGCCACGGTCGACATCCACCGCACTCGTCCCGACTGG
TACTTGTGGAACGACGGGGTGCCGGCGGGGTCGGACGGGCATCCGGGCGAGTCTGCCGAC
GAGGTCGGTGCGCGGGCCGATCGTGTCCTCGCGCGGGCGGAGAAATCGCTCGGCGACGGT
GACGTGGTGCTTGTGGCGCACGCCCACTTCCTTCGTGTCCTTACGGCGCGGCGGCTCGGG
CTGCCCGCCGCGGACGGGCGCCTGTTCCGACTCGGAACCGGCACGTTGAGCCGCCTGTCC
CTGGAACACGACCGCCCGGTCGTCAGCGAGTGGAACACCTTGCCGCCGGGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013078 Histidine phosphatase superfamily, clade-1 (Domain)
 [4-154]  1.5e-30 PF00300
PF00300   His_Phos_1
 [3-154]  1.79999754022375e-24 SM00855
SM00855   PGAM
SignalP No significant hit
TMHMM No significant hit