close all open/close all

CDS information : Sch475_00100


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction14,561 / 13,683 / - [in whole cluster]
14,561 / 13,683 / - [in contig]
Locationcomplement(13683..14561) [in whole cluster]
complement(13683..14561) [in contig]
TypeCDS
Length879 bp (292 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative NAD-dependent 6-phosphogluconate dehydrogenase
Product (GenBank)putative 6-phosphogluconate dehydrogenase
Gene
Gene (GenBank)schA10
EC number1.1.1.-
Keyword
  • PPP
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q9L9P8
PmId
[10658669] Analysis of two formaldehyde oxidation pathways in Methylobacillus flagellatus KT, a ribulose monophosphate cycle methylotroph. (Microbiology. , 2000)

close this sectionSequence

selected fasta
>putative NAD-dependent 6-phosphogluconate dehydrogenase [putative 6-phosphogluconate dehydrogenase]
MQLGLIGLGKMGGNMRERIRRAGHTVIGYDRNPDLSDVSSLTELVGKLEGPRVVWVMVPA
GAATQGVIDELGDLLEPGDTVVDGGNSRWTDDEKHAEELAAKGIGFVDAGVSGGVWGLQN
GYALMVGGDAEHIAKVQPIFDALKPEGDAGFVHAGKVGAGHFSKMVHNGIEYAMMQAYAE
GWELLEAVHSVTDVREVFRSWQEGTVIRSWLLDLAVNALDEDEHLQQLRGYAEDSGEGRW
TVEAAIDNAVPLPAITASLFARFSSRQDDSPQMKMVAALRNQFGGHAVESAK
selected fasta
>putative NAD-dependent 6-phosphogluconate dehydrogenase [putative 6-phosphogluconate dehydrogenase]
ATGCAGCTCGGGCTCATCGGCCTCGGCAAGATGGGCGGCAACATGCGCGAGCGGATCCGC
CGCGCGGGCCACACCGTGATCGGCTACGACCGCAACCCGGACCTCTCCGACGTCAGCAGC
CTGACCGAACTGGTCGGCAAGCTCGAAGGACCGCGCGTGGTCTGGGTGATGGTCCCGGCC
GGGGCCGCCACCCAGGGTGTCATCGACGAACTCGGCGACCTGCTGGAGCCGGGCGACACC
GTCGTCGACGGCGGCAACTCCCGCTGGACGGACGACGAGAAGCACGCCGAGGAGCTGGCG
GCCAAGGGCATCGGCTTCGTCGACGCCGGTGTCTCGGGCGGTGTCTGGGGCCTGCAGAAC
GGCTACGCCCTGATGGTCGGCGGCGACGCCGAGCACATCGCCAAGGTCCAGCCGATCTTC
GACGCCCTCAAGCCGGAGGGCGACGCCGGGTTCGTCCACGCGGGCAAGGTGGGCGCCGGC
CACTTCTCGAAGATGGTCCACAACGGCATCGAGTACGCCATGATGCAGGCCTATGCCGAG
GGCTGGGAGCTCCTCGAAGCGGTGCACTCCGTCACGGATGTGCGCGAGGTGTTCCGCTCC
TGGCAGGAGGGCACGGTCATCCGTTCCTGGCTGCTCGACCTGGCGGTCAACGCGCTGGAC
GAGGACGAGCACCTGCAGCAGCTCCGCGGTTACGCGGAGGACTCCGGCGAGGGCCGCTGG
ACCGTCGAGGCGGCCATCGACAACGCCGTGCCGCTGCCCGCCATCACGGCCTCCCTCTTC
GCGCGGTTCTCGTCCCGGCAGGACGACTCGCCGCAGATGAAGATGGTCGCGGCGCTGCGC
AACCAGTTCGGCGGCCACGCCGTCGAGTCCGCGAAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004849 6-phosphogluconate dehydrogenase-related protein (Family)
 [1-291]  1.10000000000001e-105 TIGR00872
TIGR00872   Gnd_rel
IPR006114 6-phosphogluconate dehydrogenase, C-terminal (Domain)
 [160-269]  2.80000000000001e-23 PF00393
PF00393   6PGD
IPR006115 6-phosphogluconate dehydrogenase, NADP-binding (Domain)
 [2-143]  2.19999999999997e-37 PF03446
PF03446   NAD_binding_2
IPR006184 6-phosphogluconate-binding site (Binding_site)
 [228-240]  PS00461
PS00461   6PGD
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [158-289]  3.49999466863949e-41 SSF48179
SSF48179   6DGDH_C_like
IPR013328 Dehydrogenase, multihelical (Domain)
 [162-270]  4.6e-38 G3DSA:1.10.1040.10
G3DSA:1.10.1040.10   Opine_DH
IPR015815 Hydroxy monocarboxylic acid anion dehydrogenase, HIBADH-type (Family)
 [1-290]  2.59999946718995e-09 PIRSF000103
PIRSF000103   HIBADH
IPR016040 NAD(P)-binding domain (Domain)
 [1-161]  7.59999999999998e-51 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit