close all open/close all

CDS information : Sch475_00110


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction16,247 / 14,577 / - [in whole cluster]
16,247 / 14,577 / - [in contig]
Locationcomplement(14577..16247) [in whole cluster]
complement(14577..16247) [in contig]
TypeCDS
Length1,671 bp (556 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative glucose-6-phosphate isomerase
putative phosphoglucose isomerase
putative phosphohexose isomerase
Product (GenBank)glucose-6-phosphate isomerase
GeneschA11
pgi
Gene (GenBank)schA11
EC number5.3.1.9
Keyword
  • PPP
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
P96803
PmId
[9098072] Interruption of the phosphoglucose isomerase gene results in glucose auxotrophy in Mycobacterium smegmatis. (J Bacteriol. , 1997)
ACC
P0A6T1
PmId
[16046082] Escherichia coli phosphoglucose isomerase can be substituted by members of the PGI family, the PGI/PMI family, and the cPGI family. (FEMS Microbiol Lett. , 2005)

close this sectionSequence

selected fasta
>putative glucose-6-phosphate isomerase [glucose-6-phosphate isomerase]
MPDTPPSEPRTPRLTRRPEWTALEDHRAGPLLHPQLRELFAADPERASRYTVRVGDLRID
YSKHLITDETLALLQELATATDVFGLRDAMFRGERINVTEGRAVLHTALRAPLEAVVEVA
GENVVPKVHAVLDKMSDFAEQVRSGKWTGHTGRRIRNVVNIGIGGSDLGPAMAYEALRAF
TDRDLTVRFVSNVDGADLHEAVRDLDPAETLFVVASKTFTTIETITNATSARTWLLAGLG
GESEAVARHFVALSTNVEKVADFGIDTANMFEFWDWVGGRYSFDSAIGLSLMIAIGPDRF
REMLDGFHLVDEHFRTAPAESNAPLLLGLLGVWYGDFFGAQSHAVLPYSHYLSKFTAYLQ
QLDMESNGKSVDREGHPVEWQTGPVVWGTPGTNGQHAYYQLLPPGHEDDPGRSDRLRQPV
DELGAELAAQHDLLMANLFAQGQALAFGKTADEVRAEGVPEEQVPHRTFRGNHPTTTVLA
AELTPSVLGQLIALYEHKVFVQGAIWNIDSFDQWGVELGKVLAKRVEPALTEGADVPGLD
PSTAALVATYRTLRKK
selected fasta
>putative glucose-6-phosphate isomerase [glucose-6-phosphate isomerase]
GTGCCTGACACGCCTCCGTCCGAGCCCCGGACGCCCAGGCTCACCCGTCGCCCCGAGTGG
ACGGCCCTGGAGGACCACCGCGCGGGCCCGCTCCTCCATCCGCAGCTGCGCGAGCTGTTC
GCCGCGGACCCGGAGCGCGCCTCGCGCTACACCGTGCGGGTCGGTGACCTGCGCATCGAC
TACTCCAAGCACCTGATCACCGACGAGACGCTCGCGCTGCTCCAGGAACTCGCCACCGCC
ACCGACGTGTTCGGGCTGCGGGACGCGATGTTCCGCGGCGAGCGGATCAACGTCACCGAG
GGGCGGGCCGTGCTGCACACCGCGCTGCGCGCCCCGCTCGAAGCGGTCGTCGAGGTCGCC
GGCGAGAACGTCGTGCCGAAGGTGCACGCCGTGCTCGACAAGATGTCGGACTTCGCCGAG
CAGGTCCGCTCCGGCAAGTGGACCGGCCACACGGGCAGGCGCATCCGCAATGTCGTCAAC
ATCGGCATCGGCGGCTCCGACCTCGGTCCGGCGATGGCGTACGAGGCCCTGCGCGCCTTC
ACCGACCGCGATCTGACGGTCCGCTTCGTGTCCAACGTGGACGGGGCCGACCTGCACGAG
GCCGTCCGCGACTTGGACCCGGCGGAGACGCTGTTCGTCGTCGCCTCGAAGACGTTCACG
ACCATCGAGACGATCACCAATGCGACCTCGGCGCGGACCTGGCTGCTCGCCGGTCTCGGC
GGTGAGTCCGAGGCCGTGGCCCGGCACTTCGTGGCGCTGTCGACGAACGTCGAGAAGGTC
GCGGACTTCGGTATCGACACGGCCAACATGTTCGAGTTCTGGGACTGGGTCGGCGGCCGT
TACTCGTTCGACTCGGCGATCGGTCTGTCGCTGATGATCGCGATCGGCCCGGACCGCTTC
CGGGAGATGCTCGACGGCTTCCACCTCGTCGACGAGCACTTCAGGACCGCGCCCGCCGAG
TCCAACGCGCCTTTGCTGCTCGGCCTGTTGGGCGTCTGGTACGGCGACTTCTTCGGCGCC
CAGTCGCACGCGGTGCTGCCGTACTCGCACTACCTGTCCAAGTTCACCGCGTACTTGCAG
CAGCTCGACATGGAGTCCAACGGCAAGTCCGTCGACCGCGAGGGACACCCGGTCGAGTGG
CAGACCGGGCCCGTCGTGTGGGGCACGCCCGGCACCAACGGCCAGCACGCGTACTACCAG
TTGCTCCCACCAGGGCACGAAGACGATCCCGGCCGATCTGATCGGCTTCGTCAACCGGTC
GACGAGCTGGGTGCCGAACTCGCCGCCCAGCACGACCTGTTGATGGCGAACCTCTTCGCC
CAGGGCCAGGCCCTCGCGTTCGGCAAGACCGCCGACGAGGTACGCGCCGAGGGGGTGCCC
GAGGAGCAGGTCCCGCACCGCACCTTCCGCGGCAACCACCCCACGACCACGGTCCTGGCC
GCCGAGTTGACCCCGTCGGTGCTCGGCCAGCTCATCGCCCTCTACGAGCACAAGGTGTTC
GTGCAGGGCGCGATCTGGAACATCGACTCCTTCGACCAGTGGGGCGTCGAGCTCGGCAAG
GTCCTCGCCAAGCGCGTCGAACCCGCCCTCACCGAGGGCGCCGACGTCCCCGGTCTCGAT
CCCTCCACCGCCGCCCTCGTGGCCACGTACCGCACTCTGCGAAAGAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001672 Phosphoglucose isomerase (PGI) (Family)
 [158-177]  1.5e-53 PR00662 [271-289]  1.5e-53 PR00662 [348-369]  1.5e-53 PR00662 [471-489]  1.5e-53 PR00662 [489-503]  1.5e-53 PR00662 [503-516]  1.5e-53 PR00662
PR00662   G6PISOMERASE
 [17-553]  138.904 PS51463
PS51463   P_GLUCOSE_ISOMERASE_3
 [54-530]  39.573 MF_00473
MF_00473   G6P_isomerase
 [60-547]  1.1e-184 PF00342
PF00342   PGI
IPR018189 Phosphoglucose isomerase, conserved site (Conserved_site)
 [503-520]  PS00174
PS00174   P_GLUCOSE_ISOMERASE_2
 [275-288]  PS00765
PS00765   P_GLUCOSE_ISOMERASE_1
IPR023096 Phosphoglucose isomerase, C-terminal (Domain)
 [508-555]  1.7e-17 G3DSA:1.10.1390.10
G3DSA:1.10.1390.10   no description
SignalP No significant hit
TMHMM No significant hit