close all open/close all

CDS information : Sch475_00120


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction17,175 / 16,240 / - [in whole cluster]
17,175 / 16,240 / - [in contig]
Locationcomplement(16240..17175) [in whole cluster]
complement(16240..17175) [in contig]
TypeCDS
Length936 bp (311 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
ProductOpcA family protein
Product (GenBank)hypothetical protein
GeneschA12
opcA
Gene (GenBank)
EC number
Keyword
  • PPP
Note
Note (GenBank)
  • schA12
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q8NQ62
PmId
[10848959] Kinetic properties of the glucose-6-phosphate and 6-phosphogluconate dehydrogenases from Corynebacterium glutamicum and their application for predicting pentose phosphate pathway flux in vivo. (Eur J Biochem. , 2000)

close this sectionSequence

selected fasta
>OpcA family protein [hypothetical protein]
MKIDLTDTTASKINKALVEGRRAIGTPAVGMVLTMVIVTDEENAYDSIKAAEEASHEHPS
RTLVVIKRHARTPRDRTNSHLDADVRVGADAGTGETVVLRLYGEVSEHADSVVLPLLLPD
APVVVWWPVDAPEVPAKDPLGALAQRRITDMYAVEAPLAALEARAASYAPGDTDLAWTRL
TPWRSMLAAALDQARTKITSAAVESEAENPSAELLARWLEARLQVAVERVVTAGPVVTAV
RLGTKNGEIVIDRPEGPLATLSLPGQPSRTLALKVRSTSELIAEELRRLDADEMYAVALR
GDDSGEEESRA
selected fasta
>OpcA family protein [hypothetical protein]
ATGAAGATCGACCTGACCGACACCACGGCAAGCAAGATCAACAAGGCCCTAGTGGAGGGC
CGCCGCGCCATCGGCACGCCCGCCGTGGGCATGGTCCTGACGATGGTCATCGTCACGGAC
GAGGAGAACGCCTACGACTCGATCAAGGCGGCCGAGGAGGCCTCGCACGAGCACCCCTCG
CGCACCCTGGTCGTCATCAAGCGGCACGCACGCACCCCGCGCGACCGCACGAACTCGCAC
CTCGACGCCGACGTCCGGGTGGGCGCCGACGCGGGCACCGGCGAGACGGTCGTGCTGCGG
CTGTACGGGGAGGTGTCCGAGCACGCCGACTCGGTGGTCCTGCCGCTGCTGCTGCCGGAC
GCGCCGGTCGTCGTCTGGTGGCCGGTGGACGCGCCCGAGGTCCCGGCCAAGGACCCGCTG
GGCGCCCTCGCACAGCGCCGGATCACCGACATGTACGCGGTCGAGGCACCGCTCGCGGCC
CTGGAGGCCCGTGCCGCCTCGTACGCGCCGGGCGACACCGACCTGGCCTGGACCCGGCTG
ACTCCGTGGCGTTCCATGCTCGCCGCCGCCCTGGACCAGGCCCGTACGAAGATCACCTCG
GCCGCCGTGGAGAGCGAGGCCGAGAACCCGAGCGCCGAACTGCTGGCCCGCTGGCTGGAG
GCCCGCCTCCAGGTCGCGGTCGAGCGGGTCGTGACCGCGGGGCCGGTCGTCACCGCCGTC
CGGCTCGGCACCAAGAACGGCGAGATCGTCATCGACCGTCCCGAGGGTCCCCTCGCGACG
CTGTCGCTGCCGGGCCAGCCCTCGCGCACCCTCGCGCTGAAGGTCCGCAGCACCTCCGAA
CTGATTGCCGAGGAGCTGCGGCGCCTGGACGCGGACGAGATGTACGCCGTCGCCCTGCGC
GGTGACGACTCGGGAGAGGAGGAGAGCCGTGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004555 Glucose-6-phosphate dehydrogenase assembly protein OpcA (Family)
 [1-305]  3.19999999999996e-111 TIGR00534
TIGR00534   OpcA
 [50-299]  4.59999999999996e-80 PF10128
PF10128   OpcA_G6PD_assem
SignalP No significant hit
TMHMM No significant hit