close all open/close all

CDS information : Sch475_00130


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction18,848 / 17,172 / - [in whole cluster]
18,848 / 17,172 / - [in contig]
Locationcomplement(17172..18848) [in whole cluster]
complement(17172..18848) [in contig]
TypeCDS
Length1,677 bp (558 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative glucose-6-phosphate 1-dehydrogenase
Product (GenBank)putative glucose-6-phosphate-1-dehydrogenase
GeneschA13
zwf
Gene (GenBank)schA13
EC number1.1.1.49
Keyword
  • PPP
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q70AQ7
PmId
[15101992] Identification of the Entner-Doudoroff pathway in an antibiotic-producing actinomycete species. (Mol Microbiol. , 2004)

close this sectionSequence

selected fasta
>putative glucose-6-phosphate 1-dehydrogenase [putative glucose-6-phosphate-1-dehydrogenase]
MSDKRPKKAPAKASGTAAETGTPAAETAGTTPDATAADLGPESLAQALDLASDWDNPLRH
PGDRRLPKIAGPSGLVIFGVTGDLARKKLMPAVYDLANRGLLPPGFSLVGFARRDWEDED
FAQIVHDSVREHARTEFREEVWQQLAEGMRFIPGDFGDDQAFKQLRAAVEELDASRGTSG
NYAFYLSVPPKFFPKVVKQLKKHGLADAPAGSWRRAVIEKPFGHNLKSARELNKVLHDVF
EPEQVFRIDHYLGKETVQNILALRFANQMYEPVWNRSYVDHVQITMAEDIGIGGRAGYYD
GIGSARDVIQNHLLQLMALTAMEEPIAFDADSLLTEKLKVLKSVRLPEDLGEHTVRGQYA
EGWQGGAKVPGYLEEEGIDPASKTDTYAAVKLEVDNRRWAGVPFYLRTGKRLGRRVTEIA
VVFQRAPHSPFDSTATEELGANAIVFRVQPDEGMTVRFGSKVPGTSMEIRDVSMDFAYGE
SFTESSPEAYERLILDVLLGDANLFPRHQEVEESWKILDPIEEFWDKHGRPAQYASGSWG
PGEADEMLARDGRSWRRP
selected fasta
>putative glucose-6-phosphate 1-dehydrogenase [putative glucose-6-phosphate-1-dehydrogenase]
ATGAGCGACAAGCGTCCCAAGAAGGCCCCGGCGAAGGCATCCGGAACGGCAGCGGAGACC
GGGACCCCCGCAGCGGAAACGGCCGGTACGACGCCGGACGCCACCGCCGCCGACCTCGGG
CCCGAGTCCCTCGCCCAGGCGCTGGACCTCGCGTCCGACTGGGACAACCCCCTGCGTCAC
CCCGGCGACCGCCGGCTGCCGAAGATCGCCGGGCCGTCCGGTCTGGTCATCTTCGGTGTC
ACGGGCGACCTGGCCCGCAAGAAGCTGATGCCGGCCGTCTACGACCTGGCCAACCGCGGA
CTGCTCCCGCCGGGCTTCTCCCTCGTCGGTTTCGCCCGTCGCGACTGGGAGGACGAGGAC
TTCGCCCAGATCGTCCACGACTCGGTGCGCGAGCACGCCCGTACGGAGTTCCGCGAGGAG
GTCTGGCAGCAGCTCGCCGAGGGCATGCGGTTCATCCCCGGCGACTTCGGTGACGACCAG
GCGTTCAAGCAACTGCGCGCGGCCGTCGAGGAGTTGGACGCCTCCCGGGGCACCAGCGGC
AACTACGCCTTCTACCTCTCCGTACCGCCGAAGTTCTTCCCGAAGGTCGTCAAGCAGCTC
AAGAAGCACGGGCTGGCCGACGCGCCGGCGGGTTCCTGGCGGCGCGCGGTGATCGAGAAG
CCGTTCGGTCACAACCTCAAGAGCGCCCGTGAGCTGAACAAGGTCCTGCACGACGTGTTC
GAGCCGGAGCAGGTCTTCCGGATCGACCACTACCTCGGCAAGGAGACCGTCCAGAACATC
CTGGCGCTCCGCTTCGCCAACCAGATGTACGAGCCCGTCTGGAACCGGTCGTACGTCGAC
CACGTTCAGATCACCATGGCGGAGGACATCGGCATCGGCGGCCGGGCCGGGTACTACGAC
GGCATCGGCTCGGCCCGTGACGTCATCCAGAACCACCTGCTCCAGCTGATGGCGCTGACC
GCGATGGAGGAGCCCATCGCCTTCGACGCGGACTCGCTGCTCACCGAGAAGCTCAAGGTC
CTCAAGTCGGTGCGGCTGCCGGAGGACCTGGGCGAGCACACCGTGCGCGGGCAGTACGCG
GAGGGCTGGCAGGGCGGCGCCAAGGTGCCCGGCTACCTCGAAGAGGAGGGCATCGACCCC
GCGTCGAAGACCGACACGTACGCGGCCGTCAAGCTGGAGGTCGACAACCGCCGCTGGGCG
GGCGTCCCCTTCTACCTGCGGACCGGCAAGCGGCTCGGCCGGCGGGTCACCGAGATCGCG
GTCGTCTTCCAGCGCGCCCCGCACTCCCCGTTCGACTCGACCGCCACGGAGGAGCTCGGC
GCCAACGCGATCGTCTTCCGTGTCCAGCCCGACGAGGGCATGACGGTGCGCTTCGGATCG
AAGGTGCCGGGTACGTCGATGGAGATCCGGGACGTCTCCATGGACTTCGCCTACGGCGAG
TCGTTCACGGAGTCCAGCCCGGAGGCGTACGAACGGCTGATCCTGGATGTCCTGCTCGGC
GACGCCAATCTCTTCCCCCGACACCAGGAGGTGGAAGAGTCCTGGAAGATCCTCGATCCG
ATCGAGGAGTTCTGGGACAAGCACGGCAGGCCCGCGCAGTACGCCTCGGGCAGCTGGGGT
CCCGGGGAAGCCGACGAGATGCTCGCACGAGACGGACGGAGCTGGCGCAGGCCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001282 Glucose-6-phosphate dehydrogenase (Family)
 [215-228]  4.19999771339582e-47 PR00079 [239-267]  4.19999771339582e-47 PR00079 [291-308]  4.19999771339582e-47 PR00079 [309-325]  4.19999771339582e-47 PR00079 [398-424]  4.19999771339582e-47 PR00079
PR00079   G6PDHDRGNASE
 [74-557]  TIGR00871
TIGR00871   Zwf
 [45-558]  PIRSF000110
PIRSF000110   G6PD
IPR016040 NAD(P)-binding domain (Domain)
 [73-258]  3.39999999999996e-67 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR019796 Glucose-6-phosphate dehydrogenase, active site (Active_site)
 [249-255]  PS00069
PS00069   G6P_DEHYDROGENASE
IPR022674 Glucose-6-phosphate dehydrogenase, NAD-binding (Domain)
 [76-259]  1.39999999999997e-66 PF00479
PF00479   G6PD_N
IPR022675 Glucose-6-phosphate dehydrogenase, C-terminal (Domain)
 [261-556]  7.40000000000006e-102 PF02781
PF02781   G6PD_C
SignalP
 [1-36]  0.304 Signal
Bacteria, Gram-positive   
 [1-36]  0.272 Signal
Bacteria, Gram-negative   
TMHMM No significant hit