close all open/close all

CDS information : Sch475_00140


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction20,005 / 18,845 / - [in whole cluster]
20,005 / 18,845 / - [in contig]
Locationcomplement(18845..20005) [in whole cluster]
complement(18845..20005) [in contig]
TypeCDS
Length1,161 bp (386 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative transaldolase
Product (GenBank)putative trasnaldolase
GeneschA14
tal
Gene (GenBank)schA14
EC number2.2.1.2
Keyword
  • PPP
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
O04894
PmId
[8980493] Cloning and expression of transaldolase from potato. (Plant Mol Biol. , 1996)

close this sectionSequence

selected fasta
>putative transaldolase [putative trasnaldolase]
MITVTEATATTEATTTAETLKNLSAEGVSVWLDDLSRKRITSGNLAELIETKHVVGVTTN
PSIFQAAIGSGEGYEEQLADLATRGVTVDEAVRMMTTADVRAAADILRPVYDATGGRDGR
VSIEVDPRLAHDTTATIAEAKQLAWLVDRPNVMIKIPATKAGLPAITEVIGRGISVNVTL
IFSLERYREVMDAYLAGLEKARAAGLDLSTIHSVASFFVSRVDSEIDKRLAKVGTDEALA
LKGRAALANARLAYEAYEDVFSSDRWTALGGSANKQRPLWASTGVKDPSYKDTLYVDELV
APGTVNTMPEATLDATADHGEIRGDTVTGGYAQARADLEAVEKQGISYDEVVRQLEDEGV
AKFEAAWGELLDAVAVSLSRKGVDGE
selected fasta
>putative transaldolase [putative trasnaldolase]
ATGATCACTGTGACCGAAGCAACCGCGACCACCGAAGCAACCACAACAGCGGAAACCCTC
AAGAACCTCTCCGCCGAAGGCGTCTCCGTCTGGCTGGACGACCTCTCGCGCAAGCGGATC
ACGTCCGGCAACCTCGCCGAGCTCATCGAGACGAAGCACGTCGTCGGCGTCACGACCAAC
CCCTCCATCTTCCAGGCCGCGATCGGCTCGGGCGAGGGTTACGAGGAGCAGCTGGCCGAC
CTCGCCACACGCGGCGTGACGGTCGACGAGGCCGTACGGATGATGACCACCGCCGACGTC
CGCGCCGCCGCCGACATCCTGCGTCCGGTGTACGACGCGACCGGCGGCCGGGACGGCCGG
GTCTCCATCGAGGTCGACCCGCGCCTCGCCCACGACACGACGGCGACCATCGCCGAGGCC
AAGCAGCTCGCCTGGCTGGTCGACCGCCCTAACGTGATGATCAAGATCCCGGCGACGAAG
GCCGGTCTCCCCGCGATCACCGAGGTCATCGGGCGCGGCATCAGCGTCAACGTCACGCTG
ATCTTCTCGCTGGAGCGCTACCGCGAGGTGATGGACGCCTACCTGGCCGGTCTGGAGAAG
GCACGGGCCGCGGGCCTCGACCTCTCCACGATCCACTCCGTGGCCTCCTTCTTCGTCTCC
CGCGTCGACAGCGAGATCGACAAGCGGCTGGCGAAGGTGGGCACGGACGAGGCCCTCGCG
CTCAAGGGCAGGGCGGCGCTCGCCAACGCGCGGCTCGCGTACGAGGCGTACGAGGATGTC
TTCTCCTCGGACCGCTGGACCGCCCTCGGCGGGAGCGCCAACAAGCAGCGTCCGCTGTGG
GCCTCGACCGGCGTCAAGGACCCGTCCTACAAGGACACGCTGTACGTCGACGAGCTGGTC
GCGCCCGGCACGGTCAACACCATGCCGGAGGCCACGCTCGACGCAACCGCCGACCACGGC
GAGATCCGCGGCGACACGGTGACCGGCGGCTACGCCCAGGCCCGCGCCGACCTGGAGGCC
GTCGAGAAGCAGGGCATCTCGTACGACGAGGTCGTACGGCAGCTGGAGGACGAGGGCGTC
GCCAAGTTCGAGGCCGCCTGGGGCGAACTGCTCGACGCGGTCGCCGTCTCACTGAGCCGC
AAGGGAGTTGACGGAGAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001585 Transaldolase (Family)
 [30-373]  1.29999999999998e-83 PF00923
PF00923   Transaldolase
IPR004732 Transaldolase type 2 (Family)
 [27-372]  TIGR00876
TIGR00876   Tal_mycobact
 [11-386]  PIRSF036915
PIRSF036915   Trnald_Bac_Plnt
IPR013785 Aldolase-type TIM barrel (Domain)
 [19-374]  9.2000000000001e-118 G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
IPR018225 Transaldolase, active site (Active_site)
 [152-169]  PS00958
PS00958   TRANSALDOLASE_2
 [56-64]  PS01054
PS01054   TRANSALDOLASE_1
SignalP No significant hit
TMHMM No significant hit