close all open/close all

CDS information : Sch475_00150


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction22,100 / 20,025 / - [in whole cluster]
22,100 / 20,025 / - [in contig]
Locationcomplement(20025..22100) [in whole cluster]
complement(20025..22100) [in contig]
TypeCDS
Length2,076 bp (691 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative transketolase
Product (GenBank)putative transketolase
GeneschA15
tkt
Gene (GenBank)schA15
EC number2.2.1.1
Keyword
  • PPP
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
P27302
PmId
[8396116] Identification and characterization of the tktB gene encoding a second transketolase in Escherichia coli K-12. (J Bacteriol. , 1993)
[7607225] Transketolase A of Escherichia coli K12. Purification and properties of the enzyme from recombinant strains. (Eur J Biochem. , 1995)
ACC
P33570
PmId
[8396116] Identification and characterization of the tktB gene encoding a second transketolase in Escherichia coli K-12. (J Bacteriol. , 1993)
ACC
O06811
PmId
[22645655] Structure and function of the transketolase from Mycobacterium tuberculosis and comparison with the human enzyme. (Open Biol. , 2012)

close this sectionSequence

selected fasta
>putative transketolase [putative transketolase]
MSTQTPDSFEWTDLDRRAVDTARLLAADAVQKVGNGHPGTAMSLAPAAYTLFQKVMRHDP
ADPEWTGRDRFVLSPGHTSLTLYTQLFLSGYELELDDLKAFRTHGSKTPGHPEYGHTAGV
ETTTGPLGQGVANAVGMAMAARFERGLFDPEAPEGESPFDHTVWAIVSDGDLEEGISAEA
SSLAGHQKLGNLVFVYDDNHISIEGDTATAFSEDVLKRYEAYGWHVQRIEPALGGDIDPR
ALHEALTAAKAETGRPSIIAMRTIIAWPAPNAQNTEAAHGSALGAEEIAATKRLLGFDPE
QTFEVADEVLAHARRALDRGAEAHAAWNKQLAEWRTAQPARAKLFDRIVAGQLPEGWESA
LPAFEAGTSVATRAASGKVLQALGDVLPELWGGSADLAGSNNTTIDKTSSFLPKGNPLPE
ADPYGRTVHFGIREHSMAAEMNGIALHGNTRIYGGTFLVFSDYMRNAVRLSALMQLPVTY
VWTHDSIGLGEDGPTHQPVEHLASLRAIPGLNIVRPADANETSIAWAEILKRHATNPAPH
GLALTRQGVPTYEANPEAAKGGYVLRDSSTATPDVILVATGSEVQLAVTAREQLEAEGVG
TRVVSMPSVEWFEEQSPEYRASVLPPSVKARVAVEAGIGLTWYRYVGDHGRIVSLEHFGA
SADAKTLFAEFGFTPENVASAARESLAAVRG
selected fasta
>putative transketolase [putative transketolase]
ATGAGCACGCAGACACCTGACAGCTTTGAGTGGACCGATCTGGACCGGCGAGCCGTCGAC
ACGGCCCGTCTGCTTGCGGCGGACGCCGTGCAGAAGGTCGGCAACGGCCACCCGGGCACC
GCGATGAGCCTCGCACCGGCGGCGTACACCCTCTTTCAGAAGGTGATGCGACACGATCCC
GCGGATCCCGAGTGGACCGGCCGCGACCGCTTCGTCCTCTCCCCCGGCCACACCTCGCTG
ACCCTCTACACCCAGCTCTTCCTCTCCGGGTACGAGCTGGAGCTCGACGACCTCAAGGCC
TTCCGCACGCACGGCTCGAAGACGCCCGGACACCCGGAGTACGGGCACACGGCCGGGGTC
GAGACGACCACGGGCCCCCTCGGCCAGGGCGTCGCCAACGCGGTGGGCATGGCGATGGCC
GCCCGCTTCGAGCGCGGCCTGTTCGACCCCGAGGCTCCCGAGGGCGAGTCCCCCTTCGAC
CACACCGTCTGGGCAATCGTCTCGGACGGTGACCTGGAGGAGGGCATCTCCGCCGAGGCG
TCCTCGCTCGCCGGCCACCAGAAGCTCGGCAACCTCGTCTTCGTCTACGACGACAACCAC
ATCTCCATCGAGGGCGACACCGCCACCGCGTTCTCCGAGGACGTACTGAAGCGGTACGAG
GCGTACGGCTGGCACGTGCAGCGGATCGAGCCCGCGCTCGGCGGCGACATCGACCCGCGC
GCGCTCCACGAGGCCCTGACCGCGGCGAAGGCCGAGACCGGCCGCCCCTCGATCATCGCG
ATGCGCACGATCATCGCCTGGCCCGCGCCCAACGCCCAGAACACCGAGGCCGCGCACGGC
TCGGCGCTCGGCGCCGAGGAGATCGCGGCCACCAAGCGCCTCCTGGGCTTCGACCCGGAG
CAGACCTTCGAGGTCGCCGACGAGGTTCTCGCCCACGCCCGGCGGGCCCTCGACCGGGGT
GCCGAGGCGCACGCCGCCTGGAACAAGCAGCTGGCCGAGTGGCGCACCGCGCAGCCCGCG
CGCGCCAAGCTCTTCGACCGGATCGTGGCCGGTCAGCTCCCCGAGGGCTGGGAGTCCGCG
CTCCCGGCGTTCGAGGCGGGCACGTCCGTCGCGACCCGTGCCGCGTCCGGCAAGGTCCTC
CAGGCGCTCGGCGACGTACTCCCCGAGCTGTGGGGCGGCTCCGCCGACCTCGCCGGCTCG
AACAACACGACCATCGACAAGACCTCGTCCTTCCTCCCGAAGGGCAACCCGCTGCCGGAG
GCCGACCCGTACGGCCGAACCGTCCACTTCGGAATCCGTGAGCACTCGATGGCCGCGGAG
ATGAACGGCATCGCGCTGCACGGCAACACCCGGATCTACGGCGGCACGTTCCTCGTCTTC
TCCGACTACATGCGCAACGCCGTCCGCCTTTCGGCCCTGATGCAGCTGCCGGTGACGTAC
GTCTGGACGCACGACTCCATCGGCCTCGGCGAGGACGGCCCGACCCACCAGCCGGTCGAG
CACCTGGCCTCACTCCGCGCCATCCCGGGCCTGAACATCGTGCGCCCCGCCGACGCCAAC
GAGACGTCGATCGCCTGGGCCGAGATCCTCAAGCGGCACGCCACCAACCCGGCCCCGCAC
GGCCTCGCCCTCACCCGTCAGGGCGTGCCGACGTACGAGGCCAACCCCGAGGCGGCGAAG
GGCGGTTACGTCCTGCGCGACTCCTCCACCGCGACCCCGGACGTGATCCTCGTCGCGACC
GGCTCCGAGGTGCAGCTCGCCGTGACCGCGCGCGAGCAGTTGGAGGCCGAGGGCGTCGGA
ACGCGTGTGGTGTCGATGCCGTCCGTCGAGTGGTTCGAGGAGCAGTCGCCGGAGTACCGA
GCGAGCGTGCTTCCGCCGTCCGTGAAGGCCCGCGTGGCGGTCGAGGCGGGCATCGGCCTG
ACCTGGTACCGGTACGTCGGTGACCACGGACGCATCGTCTCCCTCGAACACTTCGGCGCC
TCCGCCGACGCCAAGACCCTGTTCGCCGAGTTCGGCTTCACCCCCGAGAACGTGGCCTCC
GCCGCGCGGGAATCTCTTGCCGCAGTCCGCGGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005474 Transketolase, N-terminal (Domain)
 [15-354]  6.7999999999999e-128 PF00456
PF00456   Transketolase_N
 [23-43]  PS00801
PS00801   TRANSKETOLASE_1
IPR005475 Transketolase-like, pyrimidine-binding domain (Domain)
 [370-551]  4.99996518094122e-66 SM00861
SM00861   Transket_pyr
 [369-547]  8.60000000000005e-43 PF02779
PF02779   Transket_pyr
IPR005476 Transketolase, C-terminal (Domain)
 [563-678]  4.40000000000001e-10 PF02780
PF02780   Transketolase_C
IPR005478 Transketolase, bacterial-like (Family)
 [17-684]  TIGR00232
TIGR00232   Tktlase_bact
IPR009014 Transketolase, C-terminal/Pyruvate-ferredoxin oxidoreductase, domain II (Domain)
 [551-687]  2.39999798157265e-41 SSF52922
SSF52922   Transketo_C_like
IPR015941 Transketolase-like, C-terminal (Domain)
 [561-687]  1.40000000000001e-48 G3DSA:3.40.50.920
G3DSA:3.40.50.920   Transketo_C_like
IPR020826 Transketolase binding site (Binding_site)
 [490-506]  PS00802
PS00802   TRANSKETOLASE_2
SignalP No significant hit
TMHMM No significant hit