close all open/close all

CDS information : Sch475_00160


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction22,247 / 23,140 / + [in whole cluster]
22,247 / 23,140 / + [in contig]
Location22247..23140 [in whole cluster]
22247..23140 [in contig]
TypeCDS
Length894 bp (297 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative AraC family transcriptional regulator
Product (GenBank)putative AraC-family transcriptional regulator
Gene
Gene (GenBank)schA16
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Family/Domain
FD
IPR003313, IPR018060

close this sectionSequence

selected fasta
>putative AraC family transcriptional regulator [putative AraC-family transcriptional regulator]
MADISTQDADAGDGIRTFPFPVDLSVCGVGMQVGPMEPGRTWHANEAIERVHRIDFHVVM
LFGDGPVRHMVDFTEYEVSAGELLWIRPGQVHRFSSTEAYRGTVLIMQPGFLPRATVEST
GLYRYDLPPLLRPDPAQLAGLRAALAQLEREYVDTTTLPLSLHTSVLRHSLTAFLLRLAH
LAASSADAARDQDQADTTFTRFREAVEKGFATNHSVSAYADALGYSRRTLVRAVRAATGE
TPKGFIDKRVVLEAKRLLAHTDMPIGRIGVSVGFPDAANFTKFFHQHTGVAAGGVQG
selected fasta
>putative AraC family transcriptional regulator [putative AraC-family transcriptional regulator]
ATGGCGGACATAAGCACCCAAGACGCCGACGCCGGCGACGGGATCAGGACCTTTCCCTTT
CCCGTCGACCTGAGCGTCTGCGGAGTCGGCATGCAGGTCGGTCCGATGGAGCCCGGCCGG
ACCTGGCACGCGAACGAGGCGATCGAGCGCGTCCACCGCATCGACTTCCACGTGGTCATG
CTCTTCGGGGACGGCCCGGTCCGGCACATGGTCGACTTCACCGAGTACGAGGTCTCCGCC
GGTGAGCTCCTGTGGATACGCCCCGGACAGGTCCACCGTTTCTCCAGCACGGAGGCCTAC
CGCGGAACGGTCCTGATCATGCAGCCGGGCTTCCTGCCCCGCGCCACGGTCGAGTCGACC
GGCCTCTACCGCTACGACCTGCCGCCCCTGCTCAGGCCCGACCCGGCCCAGCTCGCCGGA
CTGAGGGCCGCCCTCGCCCAGCTGGAACGCGAGTACGTCGACACGACCACGCTGCCGCTC
AGCCTGCACACCTCCGTGCTGCGGCACTCCCTGACGGCGTTCCTGTTGCGCTTGGCGCAC
CTCGCGGCCAGCTCCGCCGACGCGGCACGCGACCAGGACCAGGCGGACACCACCTTCACC
CGATTCCGCGAGGCCGTCGAGAAGGGCTTCGCCACCAACCACAGCGTCAGCGCGTACGCC
GACGCCCTCGGCTACTCCCGCCGCACCCTCGTCCGGGCGGTCCGCGCCGCGACGGGCGAG
ACCCCGAAGGGCTTCATCGACAAGCGGGTCGTCCTGGAGGCCAAGCGGCTCCTCGCCCAC
ACGGACATGCCGATCGGCCGCATCGGGGTCTCGGTGGGCTTCCCCGACGCGGCCAACTTC
ACCAAGTTCTTCCACCAGCACACCGGGGTGGCCGCCGGCGGCGTTCAGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003313 Transcription regulator HTH, AraC, arabinose-binding/dimerisation (Domain)
 [10-179]  8.80000265836278e-15 SSF51215
SSF51215   AraC_binding
 [50-150]  6e-13 PF02311
PF02311   AraC_binding
IPR009057 Homeodomain-like (Domain)
 [194-249]  6.60000000000002e-09 G3DSA:1.10.10.60 [253-291]  1.9e-11 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
 [195-246]  1.6999992228405e-06 SSF46689 [249-296]  3.49999851148921e-07 SSF46689
SSF46689   Homeodomain_like
IPR018060 DNA binding HTH domain, AraC-type (Domain)
 [200-297]  PS01124
PS01124   HTH_ARAC_FAMILY_2
 [213-296]  3.69999438558106e-23 SM00342
SM00342   HTH_ARAC
SignalP No significant hit
TMHMM No significant hit