close all open/close all

CDS information : Sch475_00170


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction24,619 / 23,237 / - [in whole cluster]
24,619 / 23,237 / - [in contig]
Locationcomplement(23237..24619) [in whole cluster]
complement(23237..24619) [in contig]
TypeCDS
Length1,383 bp (460 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative glucan endo-1,3-beta-D-glucosidase
putative endo-1,3-beta-glucanase
Product (GenBank)putative endo-1,3-beta-glucanase
Gene
Gene (GenBank)schA17
EC number3.2.1.39
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q9L816
PmId
[11932459] Isolation and biochemical characterization of an endo-1,3-beta-glucanase from Streptomyces sioyaensis containing a C-terminal family 6 carbohydrate-binding module that binds to 1,3-beta-glucan. (Microbiology. , 2002)

close this sectionSequence

selected fasta
>putative glucan endo-1,3-beta-D-glucosidase [putative endo-1,3-beta-glucanase]
MRETSGTPVRRGPLRRTLIALVSVLSLAAAGASAAEADAPAPPSGWTQVFVDDFNGTAGT
GVNTSNWQYATGHGYPGGPSNWGTGEIENMTSSTNNVALDGAGNLRITPRRDAAGNWTSG
RIETNRTDFQPPAGGKLRVQSRIQMPNVTGAAARGYWPAFWMLGAPYRGNYQNWPSVGEL
DILENVQGLNTVWATMHCGSSPGGPCNETTGLGGSTACPGATCQAGFHTYGMEWDRSTSP
EEIRFYVDGINYHTVRANQVDATTWANATNHGFFIILNVAMGGGFVDAFGGGPDGATVPG
NPLVVDYVQVLQSAGGTTPPPTGNRDAYSAIQAESFDGQSGTITETTTDSGGGQNIGALA
NGDWVQYKGVNFGSTAARQFSARVASGVGGGASGLVEVRLDSRTNAPIGTFALANTGGWQ
SWRTVPTNTSGVTGTHDVYLTFTSGQPADFVNVNWFSFAR
selected fasta
>putative glucan endo-1,3-beta-D-glucosidase [putative endo-1,3-beta-glucanase]
ATGAGGGAAACTTCAGGCACACCCGTCAGACGCGGTCCACTCCGGCGCACGCTCATCGCG
CTCGTCAGCGTGCTCAGCCTGGCGGCGGCCGGGGCATCGGCGGCAGAGGCGGACGCGCCC
GCGCCGCCCAGCGGCTGGACCCAGGTCTTCGTCGACGACTTCAACGGCACGGCGGGCACC
GGCGTCAACACCTCGAACTGGCAGTACGCGACCGGCCACGGCTACCCGGGCGGGCCCTCC
AACTGGGGCACGGGCGAGATCGAGAACATGACGTCCAGCACCAACAACGTGGCGCTGGAC
GGCGCCGGGAACCTCCGGATCACCCCGCGCCGCGACGCCGCGGGCAACTGGACCTCGGGC
CGCATCGAGACCAACCGCACCGACTTCCAGCCGCCCGCCGGTGGCAAACTGCGTGTCCAG
TCCCGGATCCAGATGCCGAACGTGACGGGCGCCGCCGCCCGCGGCTACTGGCCGGCGTTC
TGGATGCTGGGCGCGCCCTACCGCGGCAACTACCAGAACTGGCCCAGCGTCGGCGAGTTG
GACATCCTGGAGAACGTCCAGGGTCTCAACACCGTGTGGGCCACGATGCATTGCGGCTCC
AGCCCGGGCGGCCCCTGCAACGAGACGACCGGCCTCGGCGGCTCGACCGCCTGCCCGGGC
GCGACCTGCCAGGCCGGCTTCCACACGTACGGCATGGAGTGGGACCGGTCGACGAGCCCG
GAGGAGATCCGCTTCTACGTCGACGGCATCAACTACCACACCGTACGGGCGAATCAGGTC
GACGCCACGACCTGGGCGAACGCCACGAACCATGGCTTCTTCATCATCCTGAACGTGGCG
ATGGGCGGCGGTTTCGTGGACGCCTTCGGCGGCGGTCCGGACGGTGCCACCGTGCCCGGC
AACCCACTCGTCGTCGACTACGTCCAGGTGCTGCAGTCCGCGGGCGGCACCACACCTCCG
CCGACCGGCAACCGTGACGCGTACAGCGCGATCCAGGCCGAGTCGTTCGACGGTCAGAGC
GGCACTATCACCGAGACCACGACCGACTCTGGCGGCGGCCAGAACATCGGCGCCCTCGCC
AACGGCGACTGGGTGCAGTACAAGGGCGTCAACTTCGGCTCCACGGCGGCCAGGCAGTTC
AGCGCCCGGGTCGCGAGCGGTGTGGGGGGCGGCGCCAGTGGCCTGGTCGAAGTCCGCCTC
GACAGCCGTACGAACGCACCGATCGGCACCTTCGCGCTCGCCAACACCGGCGGCTGGCAG
AGCTGGCGGACCGTCCCGACGAACACCAGCGGCGTCACCGGAACGCACGACGTCTATCTG
ACCTTCACGAGCGGCCAACCGGCGGACTTCGTGAACGTGAACTGGTTCAGCTTCGCCCGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000757 Glycoside hydrolase, family 16 (Domain)
 [89-283]  5.5e-20 PF00722
PF00722   Glyco_hydro_16
IPR005084 Carbohydrate binding module family 6 (Domain)
 [329-459]  PS51175
PS51175   CBM6
 [332-459]  1.99999999999999e-39 PF03422
PF03422   CBM_6
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-41]  PS51318
PS51318   TAT
IPR006584 Cellulose binding, type IV (Domain)
 [324-460]  5.40001756046195e-61 SM00606
SM00606   CBD_IV
IPR008979 Galactose-binding domain-like (Domain)
 [323-460]  1.20000117458134e-38 SSF49785
SSF49785   Gal_bind_like
IPR008985 Concanavalin A-like lectin/glucanase (Domain)
 [29-314]  2.1000026783403e-52 SSF49899
SSF49899   ConA_like_lec_gl
IPR013320 Concanavalin A-like lectin/glucanase, subgroup (Domain)
 [26-325]  4.49999999999996e-67 G3DSA:2.60.120.200
G3DSA:2.60.120.200   ConA_like_subgrp
SignalP
 [1-34]  0.998 Signal
Eukaryota   
 [1-37]  1 Signal
Bacteria, Gram-positive   
 [1-34]  1 Signal
Bacteria, Gram-negative   
TMHMM No significant hit