close all open/close all

CDS information : Sch475_00180


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction26,100 / 25,015 / - [in whole cluster]
26,100 / 25,015 / - [in contig]
Locationcomplement(25015..26100) [in whole cluster]
complement(25015..26100) [in contig]
TypeCDS
Length1,086 bp (361 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative 2-oxoglutarate ferredoxin oxidoreductase beta subunit
Product (GenBank)putative oxidoreductase
Gene
Gene (GenBank)schA18
EC number1.2.7.3
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q9AJL9
PmId
[11401501] The genes for anabolic 2-oxoglutarate: ferredoxin oxidoreductase from Hydrogenobacter thermophilus TK-6. (Biochem Biophys Res Commun. , 2001)
[16978355] Role of two 2-oxoglutarate:ferredoxin oxidoreductases in Hydrogenobacter thermophilus under aerobic and anaerobic conditions. (FEMS Microbiol Lett. , 2006)

close this sectionSequence

selected fasta
>putative 2-oxoglutarate ferredoxin oxidoreductase beta subunit [putative oxidoreductase]
MAETTTEGPGTIEALTLVPKAEARQSMKDFKSDQEVRWCPGCGDYAILAAVQGFMPELGL
AKENIVFVSGIGCSSRFPYYMNTYGMHSIHGRAPAIATGLASSRRDLSVWVVTGDGDALS
IGGNHLIHALRRNVNLKILLFNNRIYGLTKGQYSPTSEVGKITKSTPMGSLDAPFNPVSL
AIGAEASFVARTVDSDRKHLTEVLRQAAAHPGTALVEIYQNCNIFNDGAFEVLKDRQQAE
EAVIRLEHGKPIRFGADGNRGVVRDERTGDLKAVTVTPENEPQILVHDAHSASPTTAFAL
SRLADPDTLHHTPIGVFRSVDRPVYDVQMSDQLDMAIEQNGKGDLSALLAGGDAWTVLGS
R
selected fasta
>putative 2-oxoglutarate ferredoxin oxidoreductase beta subunit [putative oxidoreductase]
ATGGCTGAGACGACCACGGAAGGCCCGGGCACGATCGAGGCGCTCACCCTGGTGCCCAAG
GCCGAGGCCAGGCAGTCCATGAAGGACTTCAAGTCCGACCAGGAAGTGCGCTGGTGCCCC
GGCTGCGGCGACTACGCGATCCTCGCGGCCGTCCAGGGCTTCATGCCCGAACTGGGCCTC
GCCAAGGAGAACATCGTCTTCGTCTCGGGCATCGGCTGCTCCTCCCGCTTCCCGTACTAC
ATGAACACCTACGGGATGCACTCCATCCACGGCCGCGCCCCCGCCATCGCCACCGGACTC
GCCTCCTCCCGCCGCGACCTGAGCGTGTGGGTGGTGACCGGGGACGGCGACGCGCTGTCC
ATCGGCGGCAACCACCTCATCCACGCCCTGCGCCGCAACGTGAACCTCAAGATCCTGCTC
TTCAACAACCGGATCTACGGCCTCACCAAAGGCCAGTACTCCCCCACCTCCGAGGTCGGC
AAGATCACCAAGTCGACCCCGATGGGCTCCCTGGACGCACCCTTCAACCCGGTGTCGCTC
GCGATCGGCGCGGAAGCGTCATTCGTGGCGCGGACCGTCGACTCCGACCGCAAGCATCTG
ACGGAGGTGCTGCGGCAGGCCGCGGCCCACCCGGGCACCGCCCTCGTCGAGATCTACCAG
AACTGCAACATCTTCAACGACGGCGCCTTCGAGGTGCTGAAGGACAGGCAGCAGGCCGAG
GAGGCGGTGATCCGCCTGGAGCACGGGAAGCCCATCCGCTTCGGCGCCGACGGCAACCGC
GGTGTCGTACGCGATGAGCGGACCGGCGACCTCAAGGCCGTCACCGTCACCCCGGAGAAC
GAGCCGCAGATCCTCGTCCACGACGCACACTCCGCCTCCCCCACCACCGCGTTCGCGCTC
TCACGACTCGCCGACCCGGACACCCTGCACCACACCCCCATCGGTGTGTTCCGCTCCGTC
GACCGGCCCGTCTACGACGTCCAGATGTCGGACCAACTCGACATGGCCATCGAACAGAAC
GGCAAGGGCGACCTCTCCGCGCTGCTCGCCGGCGGCGACGCCTGGACCGTACTCGGCTCG
CGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011766 Thiamine pyrophosphate enzyme, C-terminal TPP-binding (Domain)
 [71-218]  1.2e-29 PF02775
PF02775   TPP_enzyme_C
SignalP
 [1-23]  0.148 Signal
Bacteria, Gram-positive   
 [1-23]  0.053 Signal
Eukaryota   
TMHMM No significant hit