close all open/close all

CDS information : Sch475_00190


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction28,009 / 26,093 / - [in whole cluster]
28,009 / 26,093 / - [in contig]
Locationcomplement(26093..28009) [in whole cluster]
complement(26093..28009) [in contig]
TypeCDS
Length1,917 bp (638 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative 2-oxoglutarate ferredoxin oxidoreductase alpha subunit
Product (GenBank)putative Oxidoreductase, alpha subunit
Gene
Gene (GenBank)schA19
EC number1.2.7.3
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q9AJM0
PmId
[11401501] The genes for anabolic 2-oxoglutarate: ferredoxin oxidoreductase from Hydrogenobacter thermophilus TK-6. (Biochem Biophys Res Commun. , 2001)
[16978355] Role of two 2-oxoglutarate:ferredoxin oxidoreductases in Hydrogenobacter thermophilus under aerobic and anaerobic conditions. (FEMS Microbiol Lett. , 2006)

close this sectionSequence

selected fasta
>putative 2-oxoglutarate ferredoxin oxidoreductase alpha subunit [putative Oxidoreductase, alpha subunit]
MFTRPDLPNHSGALDDSAPLPSKDVRRLDRVIIRFAGDSGDGMQLTGDRFTSETASFGND
LSTLPNFPAEIRAPAGTLPGVSSFQLHFADHDILTPGDAPNVLVAMNPAALKANIADVPR
GAEIIVNTDEFTKRAMQKVGYATSPLQDGSLDGYSVHPVPLTTLTVEALKEFDLTRKEAE
RSKNMFALGLLSWMYHRPTEGTEKFLTTKFAKKPDIAAANIAAFRAGWNFGETTEDFAVS
YEIAPATAAFPTGTYRNISGNLALSYGLIAASQQADLPLYLGSYPITPASDILHELSRHK
NFGVRTFQAEDEIAGIGAALGAAFGGSLAVTTTSGPGVALKSETIGLAVSLELPLLVIDI
QRGGPSTGLPTKTEQADLLQAMFGRNGEAPVPIVAPRTPADCFDAAIEAARIAVTYRTPV
FLLSDGYLANGSEPWRIPDTDELPDLRVQFAQGPNHTLDDGTEVFWPYKRDPQTLARPWA
IPGTPGLEHRIGGIEKQDGSGNISYDPANHDFMVRTRQAKIDGIDVPDVEVDDPHGASTL
VLGWGSTYGPITAAVRRLRAAGEAIAQAHLRHLNPFPANLGTVLKRYDKVVIPEMNLGQL
ATLVRAKYLVDAHSYNQVNGMPFKAEQLATALKEAIDG
selected fasta
>putative 2-oxoglutarate ferredoxin oxidoreductase alpha subunit [putative Oxidoreductase, alpha subunit]
GTGTTCACCAGGCCCGACCTCCCGAATCATTCAGGCGCCCTTGATGATTCCGCCCCCCTG
CCGTCGAAGGATGTACGCCGGCTGGACCGGGTGATCATCAGGTTCGCGGGGGACTCCGGT
GACGGTATGCAGCTCACCGGGGACCGCTTCACCTCCGAGACGGCATCCTTCGGAAACGAC
CTTTCGACACTGCCGAACTTCCCCGCCGAGATCCGCGCGCCCGCAGGCACCCTGCCGGGC
GTTTCGTCTTTCCAGCTGCATTTCGCCGACCACGACATCCTCACCCCCGGCGACGCGCCC
AACGTCCTCGTGGCGATGAACCCGGCCGCCCTGAAGGCGAACATCGCCGACGTACCGCGC
GGCGCGGAGATCATCGTCAACACGGACGAGTTCACCAAACGGGCGATGCAGAAGGTCGGC
TACGCCACGAGCCCCCTTCAGGACGGTTCGCTGGACGGCTACAGCGTCCACCCCGTCCCC
CTCACCACGCTGACCGTCGAGGCCCTCAAGGAGTTCGACCTCACCCGCAAGGAGGCCGAG
CGCAGCAAGAACATGTTCGCGCTGGGGCTGCTGAGCTGGATGTACCACCGGCCGACCGAG
GGCACCGAGAAGTTCCTCACCACCAAGTTCGCCAAGAAGCCCGATATCGCGGCGGCCAAC
ATCGCCGCGTTCCGCGCGGGCTGGAACTTCGGCGAGACCACCGAGGACTTCGCCGTCTCC
TATGAGATCGCGCCGGCCACCGCGGCCTTCCCGACCGGCACCTACCGCAACATCTCCGGG
AACCTGGCCCTGTCCTACGGCCTGATCGCCGCCTCCCAGCAGGCGGACCTGCCCCTCTAC
CTGGGCTCGTATCCGATCACCCCGGCCTCCGACATCCTGCACGAACTGTCCAGGCACAAG
AACTTCGGCGTCCGGACCTTCCAGGCCGAGGACGAGATCGCCGGCATCGGCGCCGCACTG
GGCGCCGCCTTCGGCGGCTCGCTCGCCGTCACCACCACCTCCGGACCGGGTGTCGCGCTC
AAGAGCGAGACGATCGGGCTCGCGGTGTCGCTGGAACTGCCGCTGCTGGTCATCGACATC
CAGCGCGGCGGCCCCTCCACCGGTCTGCCGACGAAGACGGAACAGGCCGATCTGCTGCAG
GCCATGTTCGGCCGCAACGGCGAGGCACCGGTGCCGATCGTCGCCCCCCGGACCCCCGCC
GACTGCTTCGACGCCGCGATCGAGGCCGCCCGTATCGCAGTCACCTATCGCACCCCGGTG
TTCCTTCTGAGCGACGGCTATCTGGCCAACGGATCCGAACCGTGGCGGATCCCGGACACC
GACGAACTCCCCGACCTGCGCGTGCAGTTCGCCCAGGGCCCCAACCACACCCTGGACGAC
GGCACCGAAGTCTTCTGGCCCTACAAACGCGACCCCCAGACCCTCGCCCGCCCGTGGGCC
ATCCCGGGAACACCCGGTCTCGAACACCGGATCGGCGGCATCGAGAAGCAGGACGGCTCG
GGCAACATCTCCTACGACCCCGCCAACCACGACTTCATGGTCCGCACCCGCCAGGCCAAG
ATCGACGGCATCGACGTACCGGATGTGGAAGTCGACGACCCGCACGGCGCCAGCACCCTT
GTCCTGGGCTGGGGCTCCACCTACGGACCCATCACCGCGGCCGTGCGGCGGCTGCGCGCG
GCCGGGGAAGCGATCGCGCAGGCGCATCTACGGCACCTCAACCCGTTCCCGGCGAATCTG
GGCACGGTGCTGAAGCGTTACGACAAGGTGGTGATCCCCGAGATGAACCTCGGCCAGCTC
GCCACCCTGGTCAGGGCGAAATACCTGGTGGACGCCCACTCCTACAACCAGGTCAACGGA
ATGCCGTTCAAGGCCGAACAACTCGCCACGGCTCTCAAGGAGGCCATCGATGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002869 Pyruvate-flavodoxin oxidoreductase, central domain (Domain)
 [29-253]  8e-16 SSF53323
SSF53323   Pyruvate-ferredoxin oxidoreductase, PFOR, domain III
IPR002880 Pyruvate flavodoxin/ferredoxin oxidoreductase, N-terminal (Domain)
 [282-476]  1.7e-51 PF01855
PF01855   POR_N
IPR009014 Transketolase, C-terminal/Pyruvate-ferredoxin oxidoreductase, domain II (Domain)
 [527-638]  3.9e-16 SSF52922
SSF52922   TK C-terminal domain-like
IPR015941 Transketolase-like, C-terminal (Domain)
 [536-635]  1e-09 G3DSA:3.40.50.920
G3DSA:3.40.50.920   no description
IPR019752 Pyruvate/ketoisovalerate oxidoreductase, catalytic domain (Domain)
 [39-228]  4.5e-27 PF01558
PF01558   POR
 [32-230]  2.7e-11 G3DSA:3.40.920.10
G3DSA:3.40.920.10   no description
IPR022367 2-oxoacid:acceptor oxidoreductase, alpha subunit (Family)
 [31-631]  4.6e-197 TIGR03710
TIGR03710   OAFO_sf: 2-oxoacid:acceptor oxidoreductase, alpha
SignalP No significant hit
TMHMM No significant hit