close all open/close all

CDS information : Sch475_00200


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction29,818 / 28,019 / - [in whole cluster]
29,818 / 28,019 / - [in contig]
Locationcomplement(28019..29818) [in whole cluster]
complement(28019..29818) [in contig]
TypeCDS
Length1,800 bp (599 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acyl-CoA carboxylase alpha subunit
Product (GenBank)putative Acyl-CoA carboxylase
Gene
Gene (GenBank)schP1
EC number6.4.1.-
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q9X4K6
PmId
[10589718] Genetic and biochemical characterization of the alpha and beta components of a propionyl-CoA carboxylase complex of Streptomyces coelicolor A3(2). (Microbiology. , 1999)
ACC
Q9RGQ6
PmId
[10589718] Genetic and biochemical characterization of the alpha and beta components of a propionyl-CoA carboxylase complex of Streptomyces coelicolor A3(2). (Microbiology. , 1999)

close this sectionSequence

selected fasta
>putative acyl-CoA carboxylase alpha subunit [putative Acyl-CoA carboxylase]
MSAALLGLRQARIRKVLIANRGEIAVRVARACRDAGIASVAVYAEPDRDALHVRAADEAF
ALGGDTPATSYLDMAKVLQAAKDSGADAIHPGYGFLSENADFAQAVLDAQLIWIGPPPQA
IRDLGDKAHIAQRAGAPLVAGTPDPVSGSDEVVAFAEEHGLPIAIKAAFGGGGRGLKVAR
TLEEVPELYDSAVREAVAAFGRGECFVERYLDKPRHVETQCLADSHGNVVVVSTRDCSLQ
RRHQKLVEEAPAPFLSDEQVAELYSSSKAILKEAGYVGAGTVEFLVGTDGTISFLEVNTR
LQVEHPVTEEVAGIDLVREMFRIADGEELGYGDPELRGHSFEFRINGEDPGRGFLPAPGT
VTTFAPPSGPGVRLDAGVESGSVIGPAWDSLLAKLIVTGATREQALQRAARALAEFNVEG
MATAIPFHRAVVKDPALRPELTGSTDPFTVHTRWIETEFVNDIKPFAAPADTEVEDEPGR
ETVVVEVGGKRLEVSLPVSLGMSLARTGLAAGAKPKRRAAKKSGPAASGDTLASPMQGTI
VKVAVEEGQEVKEGDLVVVLEAMKMEQPLNAHRSGTVKALSAEVGASVTSGALICEINS
selected fasta
>putative acyl-CoA carboxylase alpha subunit [putative Acyl-CoA carboxylase]
ATGAGCGCCGCCCTCCTAGGCCTCCGTCAGGCCCGCATACGCAAGGTGTTGATCGCCAAC
CGTGGCGAAATCGCTGTTCGTGTCGCCCGGGCGTGCCGAGACGCCGGTATCGCGAGCGTG
GCGGTGTACGCCGAGCCGGACCGGGACGCACTGCATGTGCGGGCCGCGGACGAGGCGTTC
GCGCTGGGCGGTGACACCCCCGCGACCAGCTACCTCGACATGGCCAAGGTGCTGCAGGCC
GCCAAGGACTCCGGCGCGGACGCCATCCACCCCGGTTACGGCTTCCTTTCCGAGAACGCC
GACTTCGCCCAGGCCGTCCTGGACGCCCAGCTGATCTGGATCGGCCCGCCGCCGCAGGCG
ATTCGCGACCTGGGTGACAAGGCCCATATCGCCCAGCGCGCCGGCGCCCCGCTGGTCGCC
GGCACCCCCGACCCGGTCTCGGGCTCGGACGAGGTCGTCGCCTTCGCGGAGGAGCACGGG
CTGCCGATCGCCATCAAGGCCGCCTTCGGTGGCGGTGGCCGCGGTCTGAAGGTCGCCCGC
ACCCTGGAAGAAGTCCCCGAGCTGTACGACTCGGCCGTCCGCGAGGCGGTGGCCGCCTTC
GGCCGCGGTGAGTGCTTCGTCGAGCGCTACCTCGACAAGCCCCGGCACGTGGAGACCCAG
TGCCTGGCCGACTCCCACGGCAACGTGGTCGTCGTCTCCACCCGCGACTGCTCACTGCAG
CGCCGCCACCAGAAGCTGGTCGAGGAGGCGCCCGCGCCGTTCCTCTCCGACGAGCAGGTC
GCCGAGCTGTACTCCTCTTCGAAGGCCATCCTCAAGGAGGCCGGCTATGTCGGCGCCGGG
ACCGTGGAGTTCCTGGTCGGCACGGACGGCACGATCTCCTTCCTGGAGGTCAACACCCGC
CTGCAGGTGGAGCACCCGGTGACCGAGGAGGTCGCCGGCATCGACCTCGTCCGCGAGATG
TTCCGCATCGCCGACGGTGAGGAGCTCGGCTACGGCGACCCGGAACTGCGCGGCCACTCC
TTCGAGTTCCGCATCAACGGCGAGGACCCGGGCCGCGGCTTCCTGCCCGCTCCCGGCACG
GTGACCACCTTCGCCCCGCCGTCCGGCCCGGGCGTGCGGCTGGACGCGGGCGTGGAGAGC
GGCAGCGTCATCGGCCCGGCCTGGGACTCCCTCCTCGCCAAGCTCATCGTCACCGGCGCC
ACCCGCGAGCAGGCCCTGCAACGGGCCGCCCGCGCGCTCGCCGAGTTCAACGTCGAGGGC
ATGGCGACCGCGATCCCCTTCCACCGCGCGGTCGTCAAGGACCCCGCCCTTCGCCCCGAA
CTGACCGGCTCCACCGACCCGTTCACGGTCCACACCCGCTGGATCGAGACCGAGTTCGTC
AACGACATCAAGCCCTTCGCCGCTCCCGCGGACACCGAGGTCGAAGACGAGCCGGGCCGC
GAGACCGTCGTCGTCGAGGTCGGCGGCAAACGCCTGGAAGTCTCCCTGCCCGTCTCCCTG
GGCATGTCGCTGGCCCGCACCGGCCTCGCAGCCGGCGCCAAGCCCAAACGCCGCGCGGCC
AAGAAGTCCGGCCCCGCCGCCTCCGGCGACACCCTCGCCTCCCCCATGCAGGGCACCATC
GTCAAGGTCGCCGTCGAAGAGGGCCAGGAGGTCAAGGAAGGCGACCTCGTCGTCGTCCTG
GAGGCCATGAAGATGGAGCAGCCCCTCAACGCCCACCGCTCGGGCACCGTCAAGGCCCTG
TCCGCCGAAGTCGGCGCCTCCGTCACCTCCGGCGCCCTCATCTGCGAAATCAATTCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000089 Biotin/lipoyl attachment (Domain)
 [530-597]  14.116 PS50968
PS50968   BIOTINYL_LIPOYL
 [532-597]  1.6e-17 PF00364
PF00364   Biotin_lipoyl
IPR001882 Biotin-binding site (Binding_site)
 [554-571]  PS00188
PS00188   BIOTIN
IPR005479 Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domain (Domain)
 [294-301]  PS00867
PS00867   CPSASE_2
 [128-329]  1.6e-72 PF02786
PF02786   CPSase_L_D2
IPR005481 Carbamoyl-phosphate synthase, large subunit, N-terminal (Domain)
 [13-121]  9.6e-41 PF00289
PF00289   CPSase_L_chain
IPR005482 Biotin carboxylase, C-terminal (Domain)
 [342-455]  1.7e-33 PF02785
PF02785   Biotin_carb_C
 [342-456]  4.5e-52 SM00878
SM00878   Biotin carboxylase C-terminal domain
IPR011053 Single hybrid motif (Domain)
 [515-598]  1.6e-20 SSF51230
SSF51230   Single hybrid motif
IPR011054 Rudiment single hybrid motif (Domain)
 [337-459]  8.6e-38 SSF51246
SSF51246   Rudiment single hybrid motif
IPR011761 ATP-grasp fold (Domain)
 [128-325]  40.207 PS50975
PS50975   ATP_GRASP
IPR011764 Biotin carboxylation domain (Domain)
 [12-452]  53.188 PS50979
PS50979   BC
IPR013815 ATP-grasp fold, subdomain 1 (Domain)
 [137-210]  4.5e-19 G3DSA:3.30.1490.20
G3DSA:3.30.1490.20   no description
IPR013816 ATP-grasp fold, subdomain 2 (Domain)
 [212-457]  1.1e-84 G3DSA:3.30.470.20
G3DSA:3.30.470.20   no description
IPR016185 Pre-ATP-grasp fold (Domain)
 [12-124]  1.5e-47 SSF52440
SSF52440   PreATP-grasp domain
 [13-134]  1.7e-42 G3DSA:3.40.50.20
G3DSA:3.40.50.20   no description
SignalP
 [1-31]  0.353 Signal
Bacteria, Gram-positive   
TMHMM No significant hit