close all open/close all

CDS information : Sch475_00210


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction31,604 / 30,033 / - [in whole cluster]
31,604 / 30,033 / - [in contig]
Locationcomplement(30033..31604) [in whole cluster]
complement(30033..31604) [in contig]
TypeCDS
Length1,572 bp (523 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acyl-CoA carboxylase beta subunit
Product (GenBank)putative methyl malonyl Co-A decarboxylase
Gene
Gene (GenBank)schP2
EC number6.4.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
O86517
PmId
[11526020] Role of an essential acyl coenzyme A carboxylase in the primary and secondary metabolism of Streptomyces coelicolor A3(2). (Appl Environ Microbiol. , 2001)
[12048195] Kinetic and structural analysis of a new group of Acyl-CoA carboxylases found in Streptomyces coelicolor A3(2). (J Biol Chem. , 2002)
ACC
Q9X4K7
PmId
[10589718] Genetic and biochemical characterization of the alpha and beta components of a propionyl-CoA carboxylase complex of Streptomyces coelicolor A3(2). (Microbiology. , 1999)
[12048195] Kinetic and structural analysis of a new group of Acyl-CoA carboxylases found in Streptomyces coelicolor A3(2). (J Biol Chem. , 2002)

close this sectionSequence

selected fasta
>putative acyl-CoA carboxylase beta subunit [putative methyl malonyl Co-A decarboxylase]
MTIMEERRPTATHVEELARLKRQVHEGPGERATSAQHARGKLTARERIQLLMDEGTFSEV
EPLRRHRATGFGLEANRPYTDGVITGWGTVHGRTVFVYAHDFRIFGGSLGEAHATKIHKI
MDMAITAGAPLVSLNDGAGARIQEGVSALAGYGGIFQRNTRASGVIPQISVMLGPCAGGA
AYSPALTDFVFMVRETSQMFITGPDVVKAVTGEEITQNGLGGADVHAETSGVAHFAYDDE
ETCIAEVRYLLSMLPQNNRDVPPRVDPDDRADRRTDAVLDLVPVDGNRPYDMTKVIGELV
DDGDYLEVHERWARNIICALARLDGQVVGIVANQPQSMAGVLDIAASEKAARFVQLCDAF
SIPLVTLLDVPGFLPGVDQEHGGVIRHGAKLLYAYCNATVPRISLILRKAYGGAYIVMDS
QSIGADLTYAWPTNEIAVMGAEGAANVVFRRQIAAADDPEAMRARLVKEYKAELMHPYYA
AERGLVDDVIDPAETRTVLIRSLAMLRTKHAELPSRKHGNPPQ
selected fasta
>putative acyl-CoA carboxylase beta subunit [putative methyl malonyl Co-A decarboxylase]
ATGACCATCATGGAGGAGCGGCGGCCGACGGCCACGCACGTCGAGGAGCTGGCCAGGCTC
AAGAGGCAGGTGCACGAGGGTCCCGGCGAACGCGCGACCTCGGCCCAGCACGCCCGCGGC
AAGCTGACAGCCCGTGAACGCATCCAACTCCTCATGGACGAAGGCACGTTCAGCGAGGTG
GAGCCGCTGCGCCGGCACCGGGCGACCGGCTTCGGCCTGGAGGCGAACCGCCCGTACACG
GACGGCGTGATCACCGGCTGGGGCACCGTGCACGGGCGCACGGTCTTCGTGTACGCCCAT
GACTTCCGCATTTTCGGCGGCTCGCTGGGCGAGGCCCACGCCACGAAGATCCACAAGATC
ATGGACATGGCCATCACGGCCGGCGCACCCCTGGTGTCCCTGAACGACGGTGCGGGCGCC
CGCATCCAGGAGGGCGTGTCCGCGCTCGCCGGCTACGGCGGCATCTTCCAGCGCAACACC
CGCGCCTCGGGCGTCATCCCGCAGATCAGCGTGATGCTGGGCCCGTGCGCCGGCGGCGCC
GCGTACTCCCCGGCCCTGACGGACTTCGTGTTCATGGTCCGCGAGACCTCGCAGATGTTC
ATCACAGGACCTGACGTCGTCAAGGCGGTCACCGGCGAGGAGATCACCCAGAACGGCCTG
GGCGGCGCGGACGTCCACGCGGAGACGAGCGGCGTCGCGCACTTCGCGTACGACGACGAG
GAGACCTGCATCGCCGAGGTGCGGTATCTGCTCTCGATGCTGCCGCAGAACAACCGCGAC
GTCCCGCCCCGGGTGGACCCCGACGACCGGGCGGACCGGCGCACCGACGCCGTGCTTGAC
CTGGTCCCCGTGGACGGCAACCGGCCGTACGACATGACGAAGGTGATCGGGGAACTCGTC
GACGACGGGGACTACCTGGAGGTCCACGAGCGCTGGGCCCGCAACATCATCTGCGCACTT
GCCCGGCTCGACGGCCAGGTGGTGGGCATCGTCGCCAACCAGCCGCAGTCCATGGCCGGC
GTCCTCGACATCGCGGCCAGCGAGAAGGCGGCCCGCTTCGTGCAACTGTGCGACGCGTTC
AGCATCCCGCTGGTGACGCTGCTCGACGTGCCGGGCTTTCTGCCGGGCGTGGACCAGGAG
CACGGCGGCGTCATCCGGCACGGCGCGAAACTGCTCTACGCCTACTGCAACGCGACCGTG
CCGCGGATCTCACTGATCCTCAGGAAGGCCTACGGCGGCGCGTACATCGTCATGGACTCG
CAGTCCATCGGCGCCGACCTGACCTACGCCTGGCCGACGAACGAGATCGCGGTGATGGGT
GCGGAAGGCGCCGCCAACGTTGTCTTCCGCAGGCAGATCGCCGCCGCCGACGACCCCGAG
GCGATGCGCGCCAGGCTGGTCAAGGAGTACAAGGCCGAGCTCATGCATCCGTACTACGCG
GCCGAGCGCGGCCTGGTCGACGACGTCATCGACCCCGCCGAGACCCGTACGGTACTCATC
CGCTCCCTGGCGATGCTGCGCACCAAGCACGCGGAACTGCCCTCCCGCAAACACGGCAAC
CCCCCACAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000022 Carboxyl transferase (Domain)
 [35-520]  PF01039
PF01039   Carboxyl_trans
IPR011762 Acetyl-coenzyme A carboxyltransferase, N-terminal (Domain)
 [16-230]  PS50980
PS50980   COA_CT_NTER
IPR011763 Acetyl-coenzyme A carboxyltransferase, C-terminal (Domain)
 [231-515]  PS50989
PS50989   COA_CT_CTER
SignalP No significant hit
TMHMM No significant hit