close all open/close all

CDS information : Sch475_00220


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction33,364 / 32,312 / - [in whole cluster]
33,364 / 32,312 / - [in contig]
Locationcomplement(32312..33364) [in whole cluster]
complement(32312..33364) [in contig]
TypeCDS
Length1,053 bp (350 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 ketoreductase
Product (GenBank)putative dNDP-hexose 3-ketoreductase
Gene
Gene (GenBank)schS1
EC number
Keyword
  • L-aculose
  • amicetose
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q9ALN5
NITE
Spino_00080
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 ketoreductase [putative dNDP-hexose 3-ketoreductase]
MSAGTVAGAPVRIGVLGCADIAVRRMMPAFAASPGLEIAAVASRDLAKAERVAERFDCHP
VQGYAELLRRDNIQAVYVPLPAALHARWVEAALDAGLHVLAEKPLSTDSATTERLLCLAA
ARGLALMENVMFVHHPVHEAVRRLVADGRIGELRTFQAAFTIPRLPDDDIRYVPELGGGA
LADVGLYPLRAALHFLGPDVEVVGAHLANGAGRLVETSGAALLRTPGGVTAQITFGMEHA
YRSGYELWGSEGRITVDRAFTPPADHIPVITVQRGADIEEIRLRPADQVAATVRAFMSAV
RAGTSPSADTLRQAVLLSDVRRAGASGDGTSTTRVDKHVGSLSAVSEPSA
selected fasta
>putative NDP-hexose C-3 ketoreductase [putative dNDP-hexose 3-ketoreductase]
TTGAGCGCGGGCACGGTGGCCGGGGCCCCGGTGCGGATCGGGGTGCTGGGCTGCGCGGAC
ATCGCGGTGCGGCGCATGATGCCCGCCTTCGCCGCCTCCCCCGGCCTGGAGATCGCGGCG
GTCGCCAGCCGTGACCTCGCCAAGGCCGAACGGGTCGCCGAACGCTTCGACTGCCACCCG
GTCCAGGGGTACGCCGAGCTCCTGCGACGCGACAACATCCAGGCCGTGTACGTGCCACTG
CCCGCGGCGCTGCACGCCAGGTGGGTGGAGGCGGCGCTCGACGCGGGCCTGCACGTACTC
GCCGAGAAGCCCCTCAGCACGGATTCCGCGACCACCGAACGGCTGCTGTGCCTCGCCGCC
GCCCGGGGGCTCGCGCTGATGGAGAACGTGATGTTCGTCCACCATCCCGTGCACGAGGCG
GTGCGGCGCCTCGTCGCGGACGGCAGGATCGGTGAACTCCGCACCTTCCAGGCGGCGTTC
ACCATCCCCCGGCTCCCCGACGACGACATCCGGTACGTCCCCGAGCTCGGCGGCGGCGCA
CTGGCGGACGTGGGGCTCTATCCGCTGCGGGCCGCCCTGCACTTCCTCGGGCCGGACGTC
GAGGTCGTCGGTGCCCATCTCGCGAACGGCGCGGGGCGCCTCGTCGAGACGTCCGGCGCC
GCGCTGCTGCGCACACCCGGCGGAGTCACCGCGCAGATCACCTTCGGCATGGAGCACGCA
TACCGCTCCGGGTACGAACTGTGGGGCAGCGAGGGCCGGATCACCGTCGACCGCGCCTTC
ACCCCGCCGGCCGACCACATCCCCGTGATCACCGTGCAGCGTGGCGCGGACATCGAGGAG
ATCCGGCTCCGGCCCGCCGACCAGGTCGCGGCCACCGTCAGGGCCTTCATGTCGGCGGTG
CGGGCGGGCACCTCGCCGAGCGCCGACACGCTACGGCAGGCGGTGCTGCTGAGTGACGTG
CGACGAGCGGGAGCATCGGGTGATGGAACGTCAACAACACGTGTGGACAAGCACGTTGGA
AGTCTTTCTGCTGTCTCCGAGCCGTCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [11-128]  4e-24 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [142-245]  1.3e-07 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [8-152]  3.3e-40 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP
 [1-31]  0.279 Signal
Bacteria, Gram-negative   
 [1-31]  0.324 Signal
Bacteria, Gram-positive   
TMHMM No significant hit