close all open/close all

CDS information : Sch475_00230


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction34,758 / 33,361 / - [in whole cluster]
34,758 / 33,361 / - [in contig]
Locationcomplement(33361..34758) [in whole cluster]
complement(33361..34758) [in contig]
TypeCDS
Length1,398 bp (465 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)putative NDP-hexose 2, 3-dehydratase
Gene
Gene (GenBank)schS2
EC number
Keyword
  • L-aculose
  • amicetose
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase [putative NDP-hexose 2, 3-dehydratase]
MLSHTLRSRGEAALADRLALSAATTEGSQLATADFHGWLAERGRANAFRVDRIPFAELQG
WSFEESTGNLVHRSGRFFTVEGLHVTERDGPYGDGPYADWYQPIIKQPEVGILGILVKEF
DGVPHFLMQAKMEPGNPNLLQLSPTVQATRSNYTKAHQGADVKYIEHFVGPGRGRVVADA
LQSEHGSWFFRKSNRNMIVEAVGDVPLLDDFCWLTLGQIGELLHQDNVVNMDSRTVLSCL
PLPATASGALLTDIELLSWITGERARHDVHAERVPLAGLPGWRQDEMTVEHEEGRYFNVV
GVAVQAGNREVTSWTQPLFEPVGTGVTAFLTQEFDGVPHVLVHARVEGGFLDTVELGPTV
QYTPGNYAHLAEKDRPPFLDSVLDASPDRVRYGAVHSEEGGRFRNAESRYLIIDAAEHDA
PLDPPPGYTWVTPGQLTWLVRHGHYLNVQVRTLLACLNALPARAR
selected fasta
>putative NDP-hexose 2,3-dehydratase [putative NDP-hexose 2, 3-dehydratase]
ATGCTGTCCCACACCCTTCGATCGCGCGGCGAGGCCGCCCTGGCCGACCGGCTCGCGCTG
TCGGCCGCCACCACCGAGGGTTCCCAGCTGGCGACCGCCGACTTCCACGGCTGGCTCGCC
GAGCGCGGCCGGGCCAACGCGTTCCGCGTGGACCGCATCCCGTTCGCCGAGTTGCAGGGC
TGGTCGTTCGAGGAGTCCACCGGAAACCTGGTGCACCGCAGCGGCCGGTTCTTCACGGTC
GAGGGCCTGCACGTCACCGAGCGGGACGGCCCCTACGGCGACGGCCCGTACGCCGACTGG
TACCAGCCCATCATCAAGCAACCCGAGGTCGGCATCCTGGGCATCCTCGTCAAGGAGTTC
GACGGGGTGCCGCACTTCCTGATGCAGGCCAAGATGGAGCCCGGCAACCCGAATCTGCTC
CAGCTCTCCCCCACGGTCCAGGCCACCCGCAGCAACTACACCAAGGCCCACCAGGGCGCG
GACGTGAAGTACATCGAGCACTTCGTCGGCCCCGGCCGCGGCCGGGTCGTCGCGGACGCC
CTGCAGTCCGAGCACGGCTCCTGGTTCTTCCGGAAGTCCAACCGCAACATGATCGTGGAG
GCGGTCGGCGACGTCCCGCTCCTCGACGACTTCTGCTGGCTCACCCTCGGTCAGATCGGC
GAGCTGCTGCACCAGGACAATGTCGTCAACATGGACTCACGGACCGTGCTGTCCTGCCTG
CCCCTGCCGGCGACGGCGTCCGGCGCACTGCTCACCGACATCGAGCTGCTGTCCTGGATC
ACCGGGGAGCGCGCCCGGCACGACGTGCACGCCGAACGCGTACCGCTGGCCGGACTGCCC
GGCTGGCGGCAGGACGAGATGACCGTCGAGCACGAGGAGGGCCGCTACTTCAACGTCGTC
GGGGTGGCCGTCCAGGCCGGCAACCGCGAGGTCACCAGCTGGACCCAACCCCTGTTCGAG
CCGGTCGGCACCGGCGTCACCGCCTTCCTCACCCAGGAGTTCGACGGCGTCCCGCACGTC
CTGGTGCACGCCCGGGTCGAGGGCGGCTTCCTGGACACCGTGGAGCTGGGCCCCACCGTC
CAGTACACGCCGGGCAACTACGCCCACCTCGCGGAGAAGGACCGCCCGCCCTTCCTGGAC
TCGGTCCTCGACGCGTCGCCCGACCGTGTCCGCTACGGTGCCGTGCACTCGGAGGAGGGC
GGCCGGTTCCGCAACGCCGAGAGCCGCTATCTGATCATCGACGCCGCCGAGCACGACGCG
CCGCTCGACCCACCGCCCGGCTACACATGGGTCACCCCCGGCCAGCTCACCTGGCTCGTC
CGCCACGGCCACTATCTCAACGTGCAGGTCCGCACGCTGCTGGCCTGCCTCAACGCACTC
CCGGCGAGGGCACGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [32-240]  2.99999999999998e-85 PF03559 [253-457]  4.09999999999995e-84 PF03559
PF03559   Hexose_dehydrat
SignalP
 [1-33]  0.504 Signal
Eukaryota   
TMHMM No significant hit