close all open/close all

CDS information : Sch475_00250


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction38,173 / 37,175 / - [in whole cluster]
38,173 / 37,175 / - [in contig]
Locationcomplement(37175..38173) [in whole cluster]
complement(37175..38173) [in contig]
TypeCDS
Length999 bp (332 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)putative NDP-hexose 4-keto reductase
Gene
Gene (GenBank)schS4
EC number
Keyword
  • amicetose
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
O33708
NITE
Adria_00200
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[9447597] Production of the antitumor drug epirubicin (4'-epidoxorubicin) and its precursor by a genetically engineered strain of Streptomyces peucetius. (Nat Biotechnol. , 1998)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [putative NDP-hexose 4-keto reductase]
MPDLDKAAGGTVVVLGGTGFIGRHIGEAFTALGARVHLVSPSAVPRSGATATVRLDVLAA
SPREIAGLLATVGADTVVNSAGRVWQADEPQMAASNAELVTKVTEALAALPWQPRRPRLI
QLGSVHEYGAGTPGGAIAEDWPPAPVTPYGRTKLLGTQAVSRAVRDQDADAVVLRLANVI
GPGISVASLFGQVARHLAGAARADSLGEKPDELRLPPLRAARDLVDVRDVADAVVAAAVA
PGARVRGRVINVGRGEAVPVRDLIDRMIALSGLEVPVSEEGGAPPNRNDVEWQSLDISLA
RELLGWTPRRPLDTSLRELLAAVMPPVDERTG
selected fasta
>putative NDP-hexose C-4 ketoreductase [putative NDP-hexose 4-keto reductase]
TTGCCTGACCTCGACAAGGCCGCCGGCGGCACTGTCGTCGTGCTCGGCGGCACCGGGTTC
ATCGGCCGCCACATCGGTGAGGCCTTCACCGCGCTCGGGGCCCGGGTGCACCTGGTCTCC
CCCAGCGCCGTACCCCGCTCGGGCGCCACGGCCACCGTCCGCCTCGACGTGCTCGCCGCC
TCCCCCCGGGAGATCGCGGGCCTGCTCGCCACGGTCGGCGCCGACACCGTCGTCAACTCC
GCGGGGCGGGTCTGGCAGGCCGACGAGCCTCAGATGGCCGCCAGCAACGCCGAGCTGGTC
ACCAAGGTCACCGAGGCGCTCGCCGCACTCCCCTGGCAGCCGCGCAGACCCCGGCTGATC
CAGCTCGGCAGCGTCCACGAGTACGGGGCGGGCACTCCGGGAGGAGCCATCGCCGAGGAC
TGGCCGCCGGCGCCCGTCACCCCGTACGGGCGTACCAAACTCCTCGGCACCCAGGCCGTG
TCGCGGGCCGTACGGGATCAGGACGCGGACGCGGTGGTGCTCCGGCTGGCCAATGTGATC
GGCCCCGGGATCTCCGTGGCCAGTCTCTTCGGCCAGGTCGCCCGGCATCTCGCCGGGGCC
GCCCGCGCCGACTCCCTCGGCGAGAAGCCGGACGAGCTGCGGCTGCCGCCGCTGCGGGCC
GCCCGCGACCTGGTGGACGTACGGGACGTGGCGGACGCCGTGGTGGCCGCTGCCGTCGCG
CCCGGCGCGCGAGTCAGGGGGCGCGTGATCAACGTGGGCCGCGGCGAGGCCGTGCCGGTC
CGGGACCTGATCGACCGGATGATCGCGCTCAGCGGCCTCGAGGTTCCGGTGAGCGAGGAG
GGCGGCGCACCGCCGAACCGCAACGACGTCGAGTGGCAGTCCCTGGACATCTCCCTGGCG
CGCGAACTGCTCGGCTGGACGCCGCGCCGCCCGCTGGACACCTCATTGCGCGAACTGCTC
GCGGCCGTGATGCCGCCCGTCGACGAAAGGACAGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [12-253]  4.8e-34 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [11-225]  2.6e-27 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP No significant hit
TMHMM No significant hit