close all open/close all

CDS information : Sch475_00260


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction39,152 / 38,166 / - [in whole cluster]
39,152 / 38,166 / - [in contig]
Locationcomplement(38166..39152) [in whole cluster]
complement(38166..39152) [in contig]
TypeCDS
Length987 bp (328 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)putative dNDP-glucose 4, 6-dehydratase
Gene
Gene (GenBank)schS5
EC number4.2.1.46
Keyword
  • L-amicetose
  • amicetose
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q56173
NITE
Grana_00110
PmId
[7476861] Identification of Streptomyces violaceoruber Tu22 genes involved in the biosynthesis of granaticin. (Mol Gen Genet. , 1995)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [putative dNDP-glucose 4, 6-dehydratase]
MRILVTGAAGFIGSHFVRNVLEGSYSGWEDAQVTALDKLTYAGNRDNLPASHERLVFVRG
DVCDRKLLRELVPGHDAVVHFAAETHVDRSLEGAGDFFRTNVLGTQTLLDAVLDSGVERV
VHVSTDEVYGSIDEGSWTEEWPLAPNSPYAASKAGSDLVARAYWRSHGVDLSITRCSNNY
GPYQHPEKLIPLFVTNLLEGRRVPLYGEGANVREWLHVDDHCRGIHLVLNQGRAGEIYNI
GGGNERTNLAITEQLLELTGAGAEAIQRVPDRKAHDLRYSIEETKIREELGYAPRIGFEQ
GLAETVAWYRDNPDWWKAAKHGTDRAVA
selected fasta
>putative dTDP-glucose 4,6-dehydratase [putative dNDP-glucose 4, 6-dehydratase]
ATGAGGATCCTCGTCACCGGAGCGGCCGGCTTCATCGGCTCCCACTTCGTGCGCAACGTG
CTGGAGGGCTCGTACAGCGGGTGGGAGGACGCGCAGGTCACCGCCCTGGACAAGCTGACG
TACGCCGGCAACCGCGACAACCTGCCGGCCTCACACGAGCGCCTGGTGTTCGTACGCGGC
GACGTCTGCGACCGCAAGCTGCTGCGCGAGCTGGTGCCCGGCCACGACGCCGTGGTGCAC
TTCGCCGCCGAGACGCACGTCGACCGTTCCCTGGAAGGCGCGGGCGACTTCTTCCGTACG
AACGTCCTGGGCACCCAGACGCTGCTCGACGCCGTGCTCGACAGCGGCGTGGAGCGGGTC
GTGCACGTGTCCACGGACGAGGTGTACGGCTCCATCGACGAGGGCTCCTGGACGGAGGAG
TGGCCGCTCGCGCCCAACTCGCCCTACGCGGCGTCGAAGGCAGGCTCCGACCTGGTGGCC
CGCGCCTACTGGCGGAGCCACGGCGTCGACCTGTCCATCACGCGCTGCTCCAACAACTAC
GGGCCGTACCAGCACCCCGAGAAGCTCATCCCGCTGTTCGTCACGAACCTGCTCGAAGGC
CGCCGGGTCCCGTTGTACGGCGAGGGAGCCAACGTCCGTGAGTGGCTGCATGTGGACGAC
CACTGCCGGGGCATCCACCTGGTCCTGAACCAGGGCCGGGCGGGCGAGATCTACAACATC
GGCGGCGGCAACGAGCGCACCAACCTCGCCATCACCGAGCAGCTCCTCGAACTGACCGGT
GCGGGCGCCGAGGCGATCCAGCGGGTTCCCGACCGCAAGGCGCACGACCTGCGCTACTCC
ATCGAGGAGACCAAGATCCGCGAGGAGCTGGGCTACGCCCCGCGGATCGGCTTCGAACAG
GGTCTCGCCGAAACGGTCGCCTGGTACCGGGACAACCCGGACTGGTGGAAGGCCGCCAAG
CACGGAACGGACCGGGCCGTTGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [3-241]  4.59999999999996e-68 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [2-318]  4.80000000000003e-126 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [1-188]  1.9e-65 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit