close all open/close all

CDS information : Sch475_00270


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction40,216 / 39,149 / - [in whole cluster]
40,216 / 39,149 / - [in contig]
Locationcomplement(39149..40216) [in whole cluster]
complement(39149..40216) [in contig]
TypeCDS
Length1,068 bp (355 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglucose-1-phosphate thymidylyltransferase
dTDP-glucose synthase
Product (GenBank)putative dNDP-glucose synthetase
Gene
Gene (GenBank)schS6
EC number2.7.7.24
Keyword
  • L-amicetose
  • amicetose
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
[18051285] Cloning and expression of glucose-1-phosphate thymidylyltransferase gene (schS6) from Streptomyces sp. SCC-2136. (J Microbiol Biotechnol. , 2007)

close this sectionSequence

selected fasta
>glucose-1-phosphate thymidylyltransferase [putative dNDP-glucose synthetase]
MKALVLAGGSGTRLRPFSYSMPKQLIPIANTPVLVHVLENIRDLGVTDIGVIVGHRGPEI
DAALGDGSRFGVKLTYISQDAPRGLAHTVAIARDFLGDDDFVMYLGDNVLPEGVAATAEE
FTARRPAAQIVVHKVTDPRQFGVAELGPDGEVLRLVEKPREPRSDMAMVGVYFFTSAIHR
AVDSIEPSARGELEITDAIQWLLASGAEVRATQYGGYWKDAGNVEDVLDCNRYLLDRLAP
SVEGDVDDLSELLGAVVVEAGARVTRSRIEGPVIIGAGAVVENSHIGPHTSIGRGCLVSD
SAVENSIALDEASVSGVKGLRSSLIGRSASVGTSEQGVDRYRLVVGDHTRVEVTA
selected fasta
>glucose-1-phosphate thymidylyltransferase [putative dNDP-glucose synthetase]
ATGAAGGCGCTTGTGCTGGCAGGCGGTTCCGGTACCCGCTTGCGACCCTTCAGTTATTCG
ATGCCGAAACAGCTCATCCCGATCGCCAACACCCCCGTCCTGGTACATGTTCTGGAGAAC
ATCCGGGACCTGGGCGTCACCGACATCGGCGTCATCGTCGGCCACCGGGGCCCGGAGATC
GACGCCGCCCTCGGTGACGGCTCCCGTTTCGGCGTGAAACTCACCTACATCTCCCAGGAC
GCCCCGCGCGGCCTCGCCCACACGGTGGCCATCGCCCGGGACTTCCTCGGCGACGACGAC
TTCGTGATGTACCTGGGCGACAACGTGCTGCCCGAGGGCGTCGCCGCCACCGCCGAGGAG
TTCACGGCCCGGCGTCCGGCCGCGCAGATCGTGGTCCACAAGGTGACCGACCCGCGCCAG
TTCGGTGTCGCCGAACTCGGGCCGGACGGCGAGGTGCTGCGTCTGGTGGAGAAGCCGCGC
GAACCGCGCAGCGACATGGCGATGGTCGGCGTGTACTTCTTCACCTCGGCCATCCACCGG
GCGGTGGACTCGATCGAGCCCAGCGCCCGTGGCGAGCTGGAGATCACGGACGCCATCCAG
TGGCTGCTGGCCTCCGGCGCCGAGGTCCGCGCCACCCAGTACGGCGGCTACTGGAAGGAC
GCCGGGAACGTCGAGGACGTCCTGGACTGCAACCGCTACCTCCTGGACCGGCTGGCGCCG
TCCGTCGAGGGTGACGTCGACGACCTCAGCGAGCTGCTGGGCGCGGTCGTCGTCGAGGCG
GGGGCGCGCGTGACACGGTCGCGCATCGAGGGGCCGGTGATCATCGGAGCGGGCGCGGTG
GTGGAGAACAGCCACATCGGCCCGCACACGTCCATCGGGCGCGGCTGCCTGGTCAGCGAC
AGCGCCGTGGAGAACTCCATCGCCCTCGACGAGGCCTCGGTCAGCGGCGTCAAGGGCCTG
CGCAGTTCGCTGATCGGGCGGTCCGCCTCGGTCGGCACCAGTGAGCAGGGCGTCGACCGG
TACCGGCTGGTCGTCGGAGACCACACCCGAGTGGAGGTCACGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-235]  3.29999999999997e-54 PF00483
PF00483   NTP_transferase
IPR005908 Glucose-1-phosphate thymidylyltransferase, long form (Family)
 [2-352]  6.10000000000004e-126 TIGR01208
TIGR01208   RmlA_long
SignalP No significant hit
TMHMM No significant hit