close all open/close all

CDS information : Sch475_00280


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction41,437 / 40,301 / - [in whole cluster]
41,437 / 40,301 / - [in contig]
Locationcomplement(40301..41437) [in whole cluster]
complement(40301..41437) [in contig]
TypeCDS
Length1,137 bp (378 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative C-glycosyltransferase
Product (GenBank)putative C-glycosyltransferase
Gene
Gene (GenBank)schS7
EC number
Keyword
  • D-amicetose
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q9RPA7
NITE
Urd_00200
PmId
[10658661] Two new tailoring enzymes, a glycosyltransferase and an oxygenase, involved in biosynthesis of the angucycline antibiotic urdamycin A in Streptomyces fradiae Tu2717. (Microbiology. , 2000)
[12696864] The C-Glycosyltransferase UrdGT2 is unselective toward d- and l-configured nucleotide-bound rhodinoses. (J Am Chem Soc. , 2003)
[17640665] Structure and action of the C-C bond-forming glycosyltransferase UrdGT2 involved in the biosynthesis of the antibiotic urdamycin. (J Mol Biol. , 2007)

close this sectionSequence

selected fasta
>putative C-glycosyltransferase [putative C-glycosyltransferase]
MRILFVTAGSPATVFALAPLATAARNAGHQVVMAANADMMPHITGSGLAGIPTTHRPIRE
FITQDRQGNPESIPSDPVEQALFTGRWFARMGAESLPRMLEFARSWRPDLVVGGTMCYVA
PLLAAHLGIPHVRQAWDAIEADGIHPGADTELAPELAELGLDRLPEPELFVDICPPSLRP
ANAGPAQMMRYIPANGQRRLEPWMYSRGERRRICVTSGSRVAKDSYDRNFEFLRGMAKDV
TAWDVELIVAAPQEVADALTAELPGLRAGWVPLDVIAPTCDLLVHHAGGVSTLTALNAGV
PQLLIPKGAVMERPALRIAERGAAITLLPGEDTAERIADSCEELLARPGYRERAGELSAE
IATMPLPSHVVAALEQLR
selected fasta
>putative C-glycosyltransferase [putative C-glycosyltransferase]
GTGAGGATCCTCTTCGTCACCGCGGGCAGCCCCGCGACCGTCTTCGCGCTCGCCCCGCTG
GCCACCGCCGCCCGCAACGCCGGGCACCAGGTCGTGATGGCCGCGAACGCGGACATGATG
CCGCACATCACGGGCTCGGGACTGGCCGGCATCCCGACCACCCACCGGCCGATCCGGGAG
TTCATCACCCAGGACCGACAGGGCAACCCCGAGTCGATCCCCTCCGACCCCGTCGAGCAG
GCGCTGTTCACCGGCCGCTGGTTCGCCCGCATGGGCGCGGAGAGCCTCCCGCGCATGCTG
GAGTTCGCGCGGTCCTGGCGGCCGGACCTCGTCGTCGGCGGCACGATGTGCTACGTCGCC
CCGCTGCTCGCCGCGCATCTGGGCATCCCGCATGTGCGCCAGGCCTGGGACGCCATCGAG
GCCGACGGCATCCATCCGGGCGCCGACACCGAACTGGCGCCGGAGCTGGCCGAGTTGGGG
CTCGACCGGCTGCCCGAGCCCGAGCTGTTCGTCGACATCTGCCCGCCGAGCCTGCGCCCG
GCGAACGCCGGTCCCGCGCAGATGATGCGCTACATCCCGGCCAACGGGCAGCGCAGGCTC
GAACCCTGGATGTACTCGCGCGGTGAGCGGCGCCGGATCTGTGTGACCTCGGGCAGCCGG
GTCGCCAAGGACAGCTACGACCGGAACTTCGAGTTCCTGCGCGGCATGGCCAAGGACGTC
ACCGCGTGGGACGTCGAACTCATCGTCGCCGCCCCCCAGGAGGTGGCCGATGCCCTCACC
GCCGAACTGCCGGGCCTGCGGGCCGGCTGGGTCCCGCTCGACGTCATCGCGCCCACCTGC
GACCTGCTCGTCCACCACGCGGGCGGTGTCAGCACCCTGACCGCACTCAACGCGGGCGTC
CCCCAACTGCTCATCCCCAAGGGGGCCGTCATGGAACGCCCGGCCCTGCGCATCGCCGAG
CGGGGGGCGGCGATCACCCTGCTGCCCGGCGAGGACACCGCCGAGCGCATCGCCGACTCC
TGCGAGGAACTGCTCGCACGCCCCGGATACCGGGAGCGGGCGGGCGAACTCTCCGCGGAG
ATCGCCACGATGCCGCTGCCCTCCCACGTGGTGGCGGCACTGGAACAGCTCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-145]  2.5e-11 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [171-264]  2.6e-22 PF06722
PF06722   DUF1205
SignalP
 [1-34]  0.999 Signal
Bacteria, Gram-positive   
 [1-23]  0.993 Signal
Eukaryota   
 [1-23]  0.996 Signal
Bacteria, Gram-negative   
TMHMM No significant hit