close all open/close all

CDS information : Sch475_00290


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction42,039 / 41,434 / - [in whole cluster]
42,039 / 41,434 / - [in contig]
Locationcomplement(41434..42039) [in whole cluster]
complement(41434..42039) [in contig]
TypeCDS
Length606 bp (201 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose epimerase
Product (GenBank)putative NDP-hexose 3, 5-epimerase
Gene
Gene (GenBank)schS8
EC number5.1.3.-
Keyword
  • L-amicetose
  • L-aculose
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q331R1
PmId
[15049360] Cloning, expression, and biological function of a dTDP-deoxyglucose epimerase (gerF) gene from Streptomyces sp. GERI-155. (Biotechnol Lett. , 2004)
[17053005] Biosynthesis of dTDP-6-deoxy-beta-D-allose, biochemical characterization of dTDP-4-keto-6-deoxyglucose reductase (GerKI) from Streptomyces sp. KCTC 0041BP. (Glycobiology. , 2007)
ACC
Q9S0P2
NITE
Aver_00150
PmId
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>putative NDP-hexose epimerase [putative NDP-hexose 3, 5-epimerase]
MLIEEMVIPGTYLVTPRQIHDERGNFYEAMRDDTLEKATGVAFQPRQINYSVSRRHTLRG
IHSVSIPPGQAKYVTCVRGVLRDIVVDLRIGSPAFMKHQVNELDADSGRSVYVPEGVGHG
FLALTDDACICYVVSSTYVPGTQIDINPLDPELDLPWDCPEVPLISDKDAKAPTVAEARA
AGVLPRFGGTGTPRFTKAGTL
selected fasta
>putative NDP-hexose epimerase [putative NDP-hexose 3, 5-epimerase]
GTGCTGATCGAGGAAATGGTCATTCCCGGTACATATCTGGTGACGCCCCGTCAGATACAC
GATGAGCGGGGGAACTTCTACGAGGCGATGCGTGACGACACGCTGGAGAAGGCGACCGGT
GTCGCCTTCCAGCCCCGCCAGATCAACTACTCGGTGTCGAGACGCCATACGCTGCGCGGC
ATCCACAGCGTGAGCATTCCGCCGGGTCAGGCGAAGTACGTCACCTGTGTGCGGGGCGTG
CTGCGCGACATCGTGGTCGATCTGCGGATCGGTTCCCCGGCGTTCATGAAGCACCAGGTC
AACGAACTCGACGCGGATTCGGGCAGATCCGTCTATGTGCCCGAGGGCGTCGGCCACGGC
TTTCTCGCGCTCACCGACGACGCCTGCATCTGCTACGTCGTCTCCAGCACCTATGTGCCC
GGAACGCAGATCGACATCAATCCACTCGACCCCGAGCTCGATCTGCCGTGGGACTGCCCC
GAAGTCCCCCTCATCTCCGACAAGGACGCCAAGGCACCGACCGTGGCCGAGGCCAGAGCC
GCCGGCGTTCTGCCCCGGTTCGGCGGGACAGGCACGCCCCGATTCACCAAGGCAGGAACA
CTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [4-177]  6.5e-48 PF00908
PF00908   dTDP_sugar_isom
 [8-182]  5e-65 PD001462
PD001462   Q9RPA8_STRFR_Q9RPA8;
IPR011051 RmlC-like cupin domain (Domain)
 [1-182]  1.9e-65 SSF51182
SSF51182   RmlC-like cupins
IPR014710 RmlC-like jelly roll fold (Domain)
 [1-186]  4.2e-56 G3DSA:2.60.120.10
G3DSA:2.60.120.10   no description
SignalP No significant hit
TMHMM No significant hit