close all open/close all

CDS information : Sch475_00300


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction43,258 / 42,086 / - [in whole cluster]
43,258 / 42,086 / - [in contig]
Locationcomplement(42086..43258) [in whole cluster]
complement(42086..43258) [in contig]
TypeCDS
Length1,173 bp (390 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)putative O-glycosyltransferase
Gene
Gene (GenBank)schS9
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q9RP99
NITE
Urd_00060
PmId
[10662691] Function of glycosyltransferase genes involved in urdamycin A biosynthesis. (Chem Biol. , 2000)
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)
[11410375] Two sequence elements of glycosyltransferases involved in urdamycin biosynthesis are responsible for substrate specificity and enzymatic activity. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>putative glycosyltransferase [putative O-glycosyltransferase]
MRVLVICTPVPTHFLPLVPLVWALRSAGHEVVVTGQPDVLGAVRAAGLTGAVVGESFDVD
GMLLRGLAEEERPLQARPRPAPEVLGGYGKLWMGHAKSVLGHYGELVREFGPELILSDPL
EYCSLILGARLGVPVVHHRWTVDAISGPARRLVRPDFRELCEELGLPGLPDPAVLLDPCP
PSLRLPDSEPGTSIRYVPYSGGGEVPGWLRADRGPGAGRQRVAVSLGNTLALHGEPFTRD
LLHALAGRPGTEILATVPERHRAGIGAVPEHVRLIDPLPLHLFLDRCDAMVHHGGAGTAM
TATAFGLPQLTLPQLADHFPLGDRLAATGAGLTFDKAAEQDDPQLIAGALDTLLSDPAYG
AAARRLAAEMAAMPSPADVAADLEQLARQA
selected fasta
>putative glycosyltransferase [putative O-glycosyltransferase]
ATGCGCGTACTCGTGATCTGCACCCCTGTTCCCACCCACTTCCTGCCGCTCGTGCCGCTC
GTCTGGGCGCTGCGCTCGGCGGGGCACGAGGTCGTGGTGACCGGGCAGCCCGATGTGCTC
GGCGCCGTGCGGGCCGCCGGGCTGACCGGCGCGGTCGTGGGCGAGTCGTTCGACGTGGAC
GGGATGCTGCTGCGGGGACTGGCCGAGGAGGAACGGCCGTTGCAGGCGCGGCCCCGGCCC
GCGCCCGAGGTGCTCGGCGGATACGGCAAGCTCTGGATGGGGCACGCCAAGTCCGTACTC
GGCCACTACGGCGAGCTCGTCCGGGAGTTCGGGCCCGAGTTGATCCTCTCGGACCCGCTG
GAGTACTGCTCGCTGATCCTCGGCGCGCGGCTGGGCGTGCCGGTGGTGCACCACCGTTGG
ACGGTGGACGCCATCTCCGGTCCGGCCCGGCGCCTGGTGCGCCCCGACTTCCGGGAGCTG
TGCGAGGAGCTGGGCCTGCCCGGCCTGCCGGATCCGGCGGTGCTGCTCGACCCGTGCCCG
CCGTCCCTGCGGCTGCCGGACTCCGAGCCGGGCACGTCCATCCGGTACGTGCCCTACAGC
GGCGGTGGTGAGGTGCCCGGCTGGCTGCGCGCGGACCGGGGGCCCGGTGCCGGACGGCAG
CGGGTCGCCGTCTCGCTGGGCAACACCCTCGCCCTGCACGGCGAACCGTTCACCCGGGAC
CTGCTGCATGCCCTCGCGGGCCGGCCCGGCACCGAGATCCTCGCGACGGTGCCCGAGCGG
CACCGGGCCGGTATCGGCGCCGTGCCGGAACACGTACGGCTGATCGATCCGCTGCCCCTG
CACCTGTTCCTCGACCGCTGCGACGCGATGGTCCACCACGGCGGCGCGGGCACCGCGATG
ACCGCGACCGCCTTCGGGCTGCCGCAGCTCACCCTGCCCCAGCTGGCGGACCACTTCCCG
CTGGGCGACCGGCTCGCCGCGACCGGCGCGGGCCTCACCTTCGACAAGGCAGCCGAGCAG
GACGACCCGCAGCTGATCGCCGGAGCCCTGGACACCCTGCTGTCGGATCCCGCGTACGGC
GCGGCGGCCCGGCGGCTCGCCGCGGAGATGGCCGCGATGCCGTCGCCCGCCGATGTCGCG
GCCGACCTGGAACAGCTGGCCCGTCAGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010610 Domain of unknown function DUF1205 (Domain)
 [176-273]  2.1e-22 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.938 Signal
Eukaryota   
 [1-27]  0.43 Signal
Bacteria, Gram-positive   
TMHMM No significant hit